KEGG   Thermoanaerobacterium saccharolyticum: Tsac_1140Help
Entry
Tsac_1140         CDS       T02137                                 

Definition
(GenBank) Alanine racemase
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
tsh  Thermoanaerobacterium saccharolyticum
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:tsh00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    Tsac_1140
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    Tsac_1140
Enzymes [BR:tsh01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     Tsac_1140
Peptidoglycan biosynthesis and degradation proteins [BR:tsh01011]
 Precursor biosynthesis
  Racemase
   Tsac_1140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1165709..1166875
Genome map
AA seq 388 aa AA seqDB search
MFNLYRPTWAEVNLDNIIHNYKEIRKITDKNAGIMAVVKANAYGHGSYEVSKELINCGVD
YLAVATIDEALELREQGISKPILVLGYTPAKFADVFIKYDITQTAFELSYVKEVAKVAQK
LGKDAKIHVKIDTGMGRIGYNDMNKAYEEILSMSSLSGINIEGIFSHFSSSDEKDKEYTV
RQLKIFLSLIERLKKSGIYIPIRHIANSAAILDMPETHLDMVRPGIILYGSFPSDEVNKK
IDLRPTISLRSKVVYVKDVEKGEYISYNRTYRTNRKSRIATLPIGYADGLNRLLSNNHNV
IINGKYAPIVGKICMDQCMIDVTPIEDVKEGDTATIMGEADGKFISADEIAKKLKTISYE
VYCGISRRVPRIYIFNGEITKVENYLKC
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgtttaatttgtatagaccaacatgggcggaagttaatttggataatataattcacaat
tacaaggagataagaaagatcactgataaaaatgccggtataatggctgtagtcaaggca
aatgcgtatgggcacggttcgtatgaagtgtcaaaggaattgataaattgcggcgtggat
tatctggctgttgcgacaattgatgaggctttggaattaagagagcaaggcatatcaaag
ccaatactcgttttaggatatactcctgcaaaatttgctgatgtgttcataaagtacgat
attacgcagacagcatttgagctaagttatgtaaaagaagtagcaaaggtagcccaaaaa
cttggcaaggatgctaagattcatgttaagatagacacgggaatgggacgcattggctac
aatgacatgaataaagcttatgaagaaattttatccatgtcatctctttctggaatcaac
attgaaggcatatttagccatttttcgtcctcagacgaaaaagacaaggagtacacggta
aggcagcttaagatttttttaagccttatagaaaggcttaaaaagtctggtatatacatt
cctattaggcatatagcaaacagtgctgcaatattagacatgcctgagacacaccttgac
atggtaagaccggggattatactttacggcagttttccttcagatgaagtcaataagaaa
atcgatttaaggccaaccatatctttaaggtcgaaagtcgtttatgttaaagatgtagag
aaaggagaatatataagctacaacaggacatataggacaaacaggaaaagtcgcatagcc
actttgcctataggatatgcagatggattaaacaggcttttatcaaataatcacaatgtc
ataataaatggcaaatacgctcctatagttggcaaaatatgcatggatcaatgcatgatt
gatgtgacgccgattgaagatgttaaagaaggtgatacagccactattatgggagaagca
gatggcaaattcataagtgctgatgaaattgcaaagaaattaaaaactatttcttatgaa
gtatattgtggaatatccagacgggtaccaagaatatatatatttaatggagagataaca
aaagtagaaaattatttaaaatgttaa

DBGET integrated database retrieval system