KEGG   Thermoanaerobacterium saccharolyticum: Tsac_2158Help
Entry
Tsac_2158         CDS       T02137                                 

Definition
(GenBank) Manganese/iron superoxide dismutase
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
tsh  Thermoanaerobacterium saccharolyticum
Brite
Enzymes [BR:tsh01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Tsac_2158
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2198155..2198751
Genome map
AA seq 198 aa AA seqDB search
MKRLIPKKYNLVLNGISQKTLQEHYKLYEGYVNKTNEIWEKLTTSDRENANATYSQYREL
KLEETYALDGVKLHELYFENLGGTGGPATGIIASMITYDFGSYENWLNDFKACAISSRGW
TVLCFDPIDLKLHNYLQDLHNHGIISRSIPLLIIDTYEHAYFIDYGTDKKGYIDAFMNNV
KWDEVNKRVYNWIDMKKI
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaggttgatacctaaaaagtataacttagtgttaaacggcatatcgcaaaagacg
ttgcaagagcattataaattgtatgaaggatatgttaacaagacaaatgaaatttgggag
aaattaaccacgtctgatagggaaaatgcaaatgccacatacagccaatacagagaactt
aaactggaagaaacgtatgcattggatggcgtaaaactgcacgaactttactttgaaaac
cttggcggaacaggcggccctgcaacaggaataatcgcttctatgataacatacgatttc
ggctcttatgaaaactggcttaacgactttaaagcatgtgcaatatcgtcaaggggttgg
acagttctttgctttgacccaattgacttaaagcttcacaattatctgcaagatcttcac
aatcatggcatcatttcaaggtcgattccccttttaataatcgatacttacgaacacgca
tattttatagactacggaaccgacaaaaaaggatatattgatgctttcatgaacaatgtc
aaatgggatgaagtaaacaaacgtgtatacaattggatcgatatgaagaaaatttag

DBGET integrated database retrieval system