KEGG   Thermococcus sibiricus: TSIB_1596Help
Entry
TSIB_1596         CDS       T00928                                 

Definition
(GenBank) Ribulose bisphosphate carboxylase
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
tsi  Thermococcus sibiricus
Pathway
tsi00630  Glyoxylate and dicarboxylate metabolism
tsi01100  Metabolic pathways
tsi01120  Microbial metabolism in diverse environments
tsi01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tsi00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    TSIB_1596
Enzymes [BR:tsi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     TSIB_1596
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N DUF697 LigA 4HFCP_synth
Motif
Other DBs
NCBI-ProteinID: ACS90647
UniProt: C6A4V2
LinkDB All DBs
Position
1439609..1440952
Genome map
AA seq 447 aa AA seqDB search
MVKMPEKFDKIYDYYVDKNYEPNFKRDIVAVFRITPTDGYTIEQAAGAVAAESSTGTWTT
LYPWYEEERWSDLSAKAYYFHDMGDGSWIVRVAYPAHAFEEWNLPGLLASIAGNVFGMKR
VKGLRLEDLYLPEIVLRDFSGPNKGIKGVRETLEIKDRPIYGVVPKPKVGYSPEELEKLS
YELLSAGADYIKDDENLTGPWYNRFEERADVMARVIDRVEAETGEKKTWFANITADIREM
ENRLEILAEYGLPHAMVDVVIVGWASLEYIRDLAEDYDIALHAHRAMHATFTRNHYHGIS
MFVLAKLYRIIGLDQLHVGTAGAGKLEGEKWDVIQNARILREEHYKPDKNDVFHLDQKFY
HIKPAFPTSSGGLHPGNLPQVINALGSDIVLQLGGGTLGHPDGPAAGAKAVRQALDAIMQ
GISLDEYAKTHKELARALEKWGHVTPV
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
gtggtaaaaatgccagaaaagtttgataagatatatgactactatgttgacaagaactat
gagccaaattttaaaagagatatagtagcagttttcagaataacccccacagatggttac
accatagagcaagctgccggcgctgtggcagctgaaagctctactgggacatggactact
ctctatccatggtatgaagaagaaaggtggagcgatctttcagctaaagcctattacttc
catgatatgggagatgggagctggatagtaagagtagcctatcctgcacacgcttttgaa
gagtggaatctccccggcctgcttgcatcaatagccggtaacgtttttggaatgaagaga
gtaaaaggactaaggcttgaagatctttacctacctgaaatagtactcagagattttagc
gggcccaacaaagggattaaaggtgtaagagaaacactcgaaatcaaagataggcccatt
tatggtgtggttcctaagccaaaggttggatattctccagaagaattggaaaagctttct
tatgaacttctttcagcaggggccgattacataaaagacgatgagaatttaacagggcca
tggtacaaccgctttgaagaaagggccgacgtaatggcaagagttatagatagagtggaa
gcagaaactggagaaaagaaaacatggttcgctaacataacagctgatatcagagaaatg
gaaaacagacttgaaattctagctgaatacggcctacctcacgccatggtcgatgttgta
atagttggatgggccagcctagagtacatacgagatttagcagaagactatgacattgcc
ttacacgcccatcgggctatgcatgccaccttcacaagaaaccactaccatggaatatcg
atgttcgttcttgcaaagctttacaggattataggccttgaccagctccacgttggaact
gccggagctggaaagctcgaaggtgaaaagtgggacgtaatccaaaacgcaagaatccta
agagaagagcactacaagccagataagaatgatgttttccatctagatcagaagttctat
cacattaaacctgctttcccaacaagctctggtggacttcacccagggaacctgccccaa
gtcataaatgctcttggaagtgatattgtacttcaactaggcgggggaactttgggacac
ccagatggaccagctgctggagctaaagccgttagacaggcattggatgcaatcatgcag
gggatttcattagatgagtacgccaaaactcacaaagagctggcaagggctctcgaaaaa
tggggtcatgtgactccagtttga

DBGET integrated database retrieval system