KEGG   Thermococcus siculi: A3L11_01180Help
Entry
A3L11_01180       CDS       T05103                                 

Definition
(GenBank) type III ribulose-bisphosphate carboxylase
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
tsl  Thermococcus siculi
Pathway
tsl00630  Glyoxylate and dicarboxylate metabolism
tsl01100  Metabolic pathways
tsl01120  Microbial metabolism in diverse environments
tsl01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tsl00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    A3L11_01180
Enzymes [BR:tsl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     A3L11_01180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N LigA
Motif
Other DBs
NCBI-ProteinID: ASJ07908
LinkDB All DBs
Position
218616..219950
Genome map
AA seq 444 aa AA seqDB search
MVEKFDKIYDYYVDKGYEPNWKRDVVAVFRITPAKGYTIEQAAGAVAAESSTGTWTTLYP
WYEHERWADMSAKAYHFTDMGDGSWIVRIAYPEHIFEEGNMPGFLASVAGNVFGMKRVEW
LRLEDIYLPERFLRNYPGPNFGIEGVRKKLEIYDRPLYGVVPKPKVGYSPEELYNLALDL
FMGGADYLKDDENLTSPWYNRFEKRVEVVTKAMEKAENETGEKKTWFANITSPILEMERR
LEILADYGVPHAMVDVVVLGWGVLDYIRDLAEDYGIALHAHRAMHTAFARNPYHGISMFV
LAKLYRVIGVDQLHIGTAGAGKMEGEKWEVIQYKRIITEDHYVPDENDVFHLEQKFYHIK
PVFPTSSGGLHPGNIQPVIEALGKDIVLQLGGGTLGHPDGPGAGARAVRQAIDAIMQGIP
LDEYARSHKELARALEKWGHVTPV
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atggtagagaaatttgacaagatatacgactactatgttgacaagggctatgagcccaac
tggaagagggatgttgtagccgtcttccgcataacgcccgcaaagggctacaccatagag
caggcggctggagcggtcgccgccgagagctcaacggggacctggacgacgctctatccc
tggtatgagcacgagagatgggccgacatgtcggccaaagcttaccacttcacggacatg
ggcgacggcagctggatcgtgaggatagcctatccggagcacatctttgaggagggcaac
atgcccggcttcctcgcgagcgtggccggaaacgtctttggaatgaagcgcgtcgagtgg
ctccgccttgaggacatctacctcccggagcgcttccttagaaactaccccggtccgaac
ttcggtatcgagggcgtcagaaagaagctcgaaatctatgacaggccgctctacggtgtc
gtcccgaagcccaaggttggctactctccggaggagctatacaaccttgcacttgacctc
ttcatgggtggggcggactatctcaaggacgatgagaacctcacgagcccctggtataac
cgcttcgagaagagggttgaggtggttacaaaggccatggagaaggccgagaacgagacc
ggtgagaagaagacctggttcgccaacataacctcaccgatcctagagatggagaggagg
ctggagatactagccgattatggagttccacacgcaatggtcgatgtcgtcgtcctcggc
tggggcgtcctcgactacatcagggaccttgccgaagactacggcatagcgcttcatgcc
cacagggccatgcacactgcattcgccaggaacccgtaccatggcatctcgatgtttgtt
ttggcgaagctctaccgcgtcatcggtgttgaccagctccacatcgggaccgccggtgcg
ggcaagatggagggcgagaagtgggaggtcatccagtacaagcgcatcattaccgaggac
cactacgttcccgatgaaaacgacgtcttccacctcgagcagaagttctaccacataaag
cccgtcttcccgaccagttccggcggcctccacccaggcaacatccagcccgttatagag
gccctcggaaaggacatcgttctgcagcttggtggtggaactctcggccacccggacggg
ccgggagccggagccagggcagtcaggcaggcaatagacgcgataatgcagggaataccg
ctcgacgagtacgccaggagccacaaagagctcgcgagagctttggagaagtggggccac
gttacgccggtctga

DBGET integrated database retrieval system