KEGG   Trichinella spiralis: Tsp_04010Help
Entry
Tsp_04010         CDS       T01609                                 

Definition
(RefSeq) putative histone deacetylase 4
  KO
K11406  
histone deacetylase 4/5 [EC:3.5.1.98]
Organism
tsp  Trichinella spiralis
Brite
Enzymes [BR:tsp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     Tsp_04010
Chromosome [BR:tsp03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     Tsp_04010
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 784 aa AA seqDB search
MSDDSVLGALYGRREVPSVFELEQRVLALHCSYKQRQSSLVEQFQRSQQELAVRHYAESQ
HLLDEFMKERSCHAPVARHASLPTMSSPIPRANSIEASTSTNGSSPASCASGVQTSGTIS
DRTKEKLKAFIYGKRRRQLSSSDDSRQHFAPYPIPTGDFHQLRKVCSEPELDSRLASLRN
KLPDSVVFNEAASTTPLTSPCCRDFPSLLWNSNGVSSLAFPAPSLPCLPSYVAHATGGDG
YASTSVEPLNGFLRNSALFLSAPSLAGASTAPAALPTLSVPSFIGGPLAGGGLPLAPAEA
LAQAASLYGHAFAPLSRACANPPTVGVSPMEQYQYNVLRQQLRDLVLRRKSLVREETDDE
VAREGNGPSLLPRSLASLGLSDSGDGNTPKTTGIAFDLLMARHDCICSIKGQHIEEGERI
KTIWSHLQSTDLFEKCKKLNGRKAPLEYLRLCHDECYTTFFGVSPTACLKTDPTRLPLRS
FIQLPCGGIGVDADTYFNDGSTQLSARVAVGCTVDLCLAVAAGTLENGFALVRPPGHHAE
PVQAMGFCFFNNIAIAVRVLQQKKPHLKKFAIIDWDVHHGKGTQLIFENDPNVLYLSLHR
YDNGTFFPGTGSLTEVGSGAGAGFTVNIAWSGGSMGDADYLAAFAHVVLPILDQFEPDFV
LVAAGFDAADGHHVTLGGYHLSPAIFAHMTRSLLRYADSRLVLVLEGGYELKVVNECIEE
CLRVLCGQESRALSAEALAASPSESAQTVLRQLINEQRPYWPILDPKAPLSCSFRQLEAM
KTKK
NT seq 2355 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacgatagtgttttgggcgcgttgtacgggcgccgtgaggttccgtcggttttc
gaactcgaacagcgtgttctggcgttgcactgcagctacaagcaacgtcagagcagcctg
gtggagcagttccaacgttctcagcaagagctggccgtgcgccactatgcagaatcccag
catctgctcgacgagttcatgaaagaacgcagctgccacgcccctgtcgcacgccacgcc
agcttgccgacaatgtcttctccaataccccgcgccaacagcatcgaagcgtccacaagt
acgaacggaagtagtccggcatcttgtgccagcggtgtccaaacgtcaggtacgatcagt
gatcggaccaaagaaaagttgaaagctttcatttatggcaaacgaagaagacagttatca
tcgagcgatgatagtcggcaacatttcgcaccatatccaataccgacgggcgattttcac
cagttgcgcaaagtgtgcagcgaaccagagttggatagtcgtttggccagcttgaggaac
aagctgcccgactcggttgtattcaacgaagcggcttccacgacaccgctaacgtcgccc
tgttgtcgggattttccgtcattgttgtggaacagcaatggtgtgtcgtcgttggctttt
ccggcgccgtcgctgccctgcctaccttcgtatgtggcccacgctaccggcggcgacggg
tacgcttccactagtgtggaaccgttgaacggtttcttgcgcaattcggcgcttttcctg
tccgccccgtctttggccggggcgtcgacggccccggccgccctgcccacattgtcggtg
ccgtcgttcatcgggggaccgcttgccggcggcgggttgcctttggcgccggccgaggcg
ctggcccaggcggcatcgttgtacgggcacgcgtttgccccgttgagtcgcgcctgcgcc
aacccgccaacggtgggcgtttccccgatggaacagtaccagtacaacgttctgcggcaa
cagcttcgagatttggtgctcaggaggaagagtctggtgcgcgaggagaccgacgatgag
gtggctcgcgagggaaacggcccgtcgctgttgcctcggtcgttggcttcgcttggactt
tcggacagcggcgatggaaacacgcccaaaactaccggcattgcgtttgatttgctcatg
gctcgtcacgattgtatatgttcaatcaaggggcagcacatcgaagaaggggaacgtata
aaaacaatctggtctcatttgcagtccacggatctctttgaaaagtgcaaaaaattgaac
ggccgcaaagcaccgttggaatatcttcgcctttgccacgacgaatgctatacgacattt
ttcggcgtttctccgacagcatgcttgaaaaccgacccaacccggttgccgttgcgtagc
ttcatacagcttccatgcggcggtatcggtgtcgacgcggacacctacttcaacgacggt
tctacacagctgtcggcacgcgtggccgtcggctgcacggtggatctgtgcttggctgtc
gctgctggcactttggagaacggtttcgcactggttcgaccaccggggcaccatgctgaa
cctgttcaagctatgggtttctgctttttcaacaacattgccatcgctgtacgagttttg
cagcagaaaaagccccacttgaaaaagtttgccatcatcgattgggatgtgcatcacggc
aaaggaacgcagttgatttttgaaaacgatcccaacgtgttgtacttatcgttgcatcgt
tacgacaatggaacgtttttccccggcacaggcagcttgaccgaagtcggctccggtgcc
ggtgccggcttcacggtcaatatagcctggtccggcggttcgatgggcgatgcggattat
ttggctgcctttgcccacgtcgtcttgccaatattggatcaattcgagccagactttgtc
ttggtggccgccggtttcgacgcagccgacggccatcacgtcactttgggtggttatcat
ttgtcaccggcaatatttgcccacatgaccagatctctgctccgctatgccgacagtcgg
ctggtgttagtgttggaaggtggctacgagttgaaagtagtcaacgaatgtattgaagag
tgcctgcgagttttgtgcggtcaagagagtagagctttgtccgccgaagcgttggccgca
tctccatccgaaagcgcacaaactgtattaagacagttgatcaacgaacagcgtccctat
tggccaattttggatccaaaagcgccactgtcctgcagctttcgtcaactcgaagcgatg
aaaacgaaaaaataa

DBGET integrated database retrieval system