KEGG   Thermoanaerobacter tengcongensis: TTE0857Help
Entry
TTE0857           CDS       T00081                                 

Gene name
SodA
Definition
(GenBank) Superoxide dismutase
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
tte  Thermoanaerobacter tengcongensis
Brite
Enzymes [BR:tte01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     TTE0857 (SodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(866981..867547)
Genome map
AA seq 188 aa AA seqDB search
MDKLVAKKYNLVLRGISQRTLEEHYKLYNGYVEKTNEIREKLKTVDRSKANASYSEYREL
KLEETYNLDGVKLHELYFENLGGAGGIPDGIIAPMIALDFGSFENWRQDFIACGMASRGW
TVLCFDPIDLKLHNYLQDFHNHGIVLRTIPLLVLDTYEHAYFIDYGTDKKSYIEAFMNNI
KWEEVGNS
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atggataagcttgtagcaaaaaaatataatttagttttaagaggaatatctcaaaggact
cttgaagaacactacaagttgtacaatggatatgtagaaaagacaaacgaaatacgtgaa
aaattaaaaacagtcgatcgttcaaaagcaaatgccagctatagtgaatatagagaactc
aaactagaagagacttacaatttagatggagtaaaacttcacgagttatattttgaaaac
ttaggaggagcaggtggcatacctgatggcataatagccccaatgattgcacttgatttc
ggctcctttgaaaactggagacaggacttcatagcctgtggaatggcttcccgtggctgg
actgtcctttgctttgaccctatagatttaaaacttcacaattaccttcaggacttccac
aaccacggcatagtattaaggacgattcctcttctggtccttgacacctacgaacacgcc
tattttatagattacggcactgataaaaaaagctatatagaggcctttatgaacaatata
aaatgggaggaggtaggtaacagttga

DBGET integrated database retrieval system