KEGG   Thioalkalivibrio thiocyanoxidans: THITH_13610Help
Entry
THITH_13610       CDS       T03590                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
tti  Thioalkalivibrio thiocyanoxidans
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:tti00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    THITH_13610
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    THITH_13610
   00680 Methane metabolism
    THITH_13610
Enzymes [BR:tti01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     THITH_13610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2945183..2948026
Genome map
AA seq 947 aa AA seqDB search
MIQNRIDERFRPKDKELRARVRLFGELLGNVIRRLEGEAVLNAVETLRKGFVTLRKREDP
RLRERMMRCIVHQTPEMTERIIRAFSIYFSLVNIAEEDLFYRWRRAQVSSGEPLWTGSFD
RTLRQLHEEGISAAELERLLEELSYMPVFTAHPTEARRRTTMQNQRRVFRTADRLNQPRI
GAEERRSLIAELEAQIQILWRTNEVRVKKPQVRDEIKYGLFYFEESLFEAIPQTYRYLEN
AVRRTYGIRPDGSLPIRIPAFLRFGSWIGGDRDGNPNVTPEVTALACRLAMQQVLREYLR
RVAELRNVLTHSSLMCQPSADFLASLEADNSIAPAVFQGHMDRYETEPYRRKLQIMAYRL
KETLATVERRLSGESAVLPVASAYAGADAFVADLRVMHDSLVSHGERNIAASELTDLIRL
AETCGFHLHHLDVRQESTVHSAAVAAILAQTGLSADYETLAEPERIALLSELIDRTELPD
PDPEQLDAAAHETLRVFEVIRDMRQEVGSQGIGTYVISMTHAASHVLEVLFLGRLTGLAG
KTADGPFCHLRITPLFETIEDLLHVEDVLNGLLGTPTYARMLAAGGNLQEVMLGYSDSCK
DGGILASSWNLYEAQKKIVAITTRFGVRCQLFHGRGGTVGRGGGPTHESILAQPPATVQG
RIKFTEQGEVLSYKYSNVETAVYEIGVGATGLILASRGLIRAPTHDRDADMATMHELAQL
GEDAYRELVDRTPGVLDYFYEGTPVQEIGFLNIGSRPSHRRKSDRSKSSIRAIPWVFGWA
QSRHTLPAWYGIGSALAAWRGEDPARLELLQQMYRDWPFFRSLLSNTQMALTKADLRMAA
EYAKLCSDQELAERVFGKVRDEYARTVREVLLVAQLEALMDETPLLALSLQRRNPYLDPL
NSIQIHLLRESRALEAGQPEDEEIDNPWMSPLLRSINAIAAGMRNTG
NT seq 2844 nt NT seq  +upstreamnt  +downstreamnt
atgatccagaaccgcatcgacgaacgctttcggcccaaggacaaggagctgcgcgcccgc
gtccggctgttcggcgaactgctgggcaacgtgatccgccggctcgagggcgaagcggtg
ctgaacgcggtcgagacgctgcgcaagggcttcgtgaccctgcgcaagcgcgaggatccg
aggctgcgcgagcgcatgatgcgctgcattgtgcaccagacacccgagatgaccgagcgc
atcatccgggctttcagcatctacttcagcctggtcaacatcgccgaggaggacctgttc
taccgctggcgccgtgcccaggtcagcagcggcgaaccgctctggaccggttccttcgac
cgcaccctgcgccaactgcacgaggagggaatctccgccgcggaactggaacggctgctg
gaggaactcagctacatgccggtattcacggcccatcccaccgaggcgcgccggcgcacg
acgatgcagaaccagcgccgtgtattccggaccgcggatcggctcaaccagccgcggatc
ggcgccgaggagcgccggtcgctgatcgcggagctcgaggcacagatccagatcctctgg
cgcaccaacgaggtacgggtaaagaagccgcaggtgcgcgacgagatcaagtacgggctg
ttctatttcgaggaaagtctgttcgaagcgatcccgcagacctaccgctaccttgagaac
gcggtacggcgcacctacggcatccggcccgacgggagcctgcccatccggataccggcg
tttctgcgcttcggctcgtggatcggcggtgaccgcgacggcaacccgaacgtgacgccg
gaagtcaccgcgctggcctgtcgcctggcgatgcagcaggtgctccgggaatacctgcgc
cgcgttgcggaactgcgcaacgtgctcacacattcctcgctgatgtgtcagccttcggcc
gatttcctggccagcctcgaggccgacaacagcatcgcgcccgcggtgttccagggccac
atggatcgctacgagaccgagccctaccggcgcaagctgcagatcatggcgtatcgcctg
aaagagacgctggcgacggtggaacggcgcctgtccggcgagagcgcggtgctgccggtg
gcgtcggcctatgccggcgccgacgccttcgtcgcggacctgcgcgtgatgcacgactcg
ctggtcagccatggcgagcgcaacatcgccgcaagcgaactgaccgacttgatccgcctc
gccgaaacctgcggctttcacctgcatcacctcgacgtgcgccaggaatcgacggtgcac
agcgcggcggttgcggccatcctggcccagaccggactgtccgccgactatgaaacgctg
gccgaacccgaacgcatcgcgctgctgagcgaactgatcgaccggaccgaactgcccgat
ccggatcccgaacagctggatgccgctgcgcacgaaaccctgcgcgtgttcgaagtgatc
cgcgacatgcgccaggaggtcggctcccagggcatcggcacctacgtgatctcgatgacc
cacgccgcctcacatgtgctcgaggtcctgttcctcggccgcctcaccgggctggcgggc
aagaccgccgacggcccgttctgccatctgcgcatcactccgctgttcgagacgatcgag
gatctgctgcacgtggaggacgtgctcaatggcctgctcggcactccgacctatgcgcgc
atgctcgccgcgggcggcaacctccaggaagtcatgcttggctactcggattcctgcaag
gacggcggcatcctggcctcgagctggaacctctacgaggcgcagaaaaagatcgtcgcg
atcaccacgcgcttcggtgtgcgctgccagctgttccatggccgcggcggcaccgtcggc
cgcggcggcggcccgactcacgagtccatcctggcccagccaccggccacggtgcagggc
cggatcaagttcaccgaacagggcgaggtgctgtcgtacaaatacagcaacgtcgaaacc
gccgtgtacgaaatcggcgtcggtgccaccggactgatccttgcgagccgcggactgatc
cgcgcgccaacccacgaccgcgacgcagacatggcgacgatgcacgagctcgcgcagctc
ggcgaggacgcctaccgggaactggtcgaccgcacccccggagtactcgattacttctac
gaaggcacgccggtgcaggaaatcggctttctgaacatcgggtcgcgcccctcgcaccgg
cgcaagagcgaccgctcgaagagctcgatccgtgcaattccctgggttttcggctgggcc
cagtcgcgtcacaccctgcccgcctggtacggcatcgggtcggcgctggccgcctggcgc
ggagaggatccggcccggctggagctgctgcagcagatgtaccgcgactggccgttcttc
cgctcgctgctgtccaacacccagatggcgctgaccaaggccgacctgcgcatggccgcc
gagtacgcgaaactgtgcagcgaccaggaactggcggagcgagtgttcgggaaagtgcgc
gacgagtacgcacgcacggtgcgcgaggtgctgctggtggcccagctcgaggcgctgatg
gacgaaacgccgctgctggcgctgtcgctgcagcggcgcaatccctacctggatccgctg
aacagcatccagatccacctgctgcgcgaatcgcgggcgctggaggccggacagccggaa
gacgaggaaatagacaacccctggatgtcgccgctattgcgttcgatcaatgccatcgcg
gcggggatgcgcaacaccggttga

DBGET integrated database retrieval system