KEGG   Thermoanaerobacterium thermosaccharolyticum DSM 571: Tthe_0416Help
Entry
Tthe_0416         CDS       T01299                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
ttm  Thermoanaerobacterium thermosaccharolyticum DSM 571
Brite
Translation factors [BR:ttm03012]
 Eukaryotic Type
  Elongation factors
   Tthe_0416
 Prokaryotic Type
   Tthe_0416
Mitochondrial biogenesis [BR:ttm03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Tthe_0416
Exosome [BR:ttm04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Tthe_0416
  Exosomal proteins of breast cancer cells
   Tthe_0416
  Exosomal proteins of colorectal cancer cells
   Tthe_0416
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
412274..413476
Genome map
AA seq 400 aa AA seqDB search
MAKQKFERKKPHANIGTIGHVDHGKTTLTSAITIVLSKQGMAQATAYDEIDKAPEEKARG
ITINTMHVEYETEKRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLARQVGVPYIVVFLNKADMVDDEELIELVEMEVRELLNEYEFPGDDTPIVVGSALKAME
CGCGQRDCQWCGKIWELMDVVDSYIPTPERDVDKPFLMPVEDVFTITGRGTVATGRVERG
KLKVGDEVEIIGLSDESKKTVVTGVEMFRKTLDEAEAGDNIGVLLRGVTRDEVERGQVLA
KPGSVKPHTKFEGQVYVLTKEEGGRHTPFFNGYRPQFYFRTTDVTGVIELPEGVEMVMPG
DHVTMTIELITPIAMEEGLKFAIREGGHTVGAGVVSKILS
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagcaaaaatttgaaagaaagaaaccccatgcaaacataggaacgatagggcac
gtagaccatggcaaaacgacgttaacatcagcaataacaatagtattgtcaaagcaaggg
atggcacaagccacagcatatgatgaaatagacaaagcaccagaagagaaagcaagagga
ataacaataaacacaatgcacgtagaatacgagacagagaaaaggcactatgcgcatgta
gactgtccagggcacgcagactacgtaaagaacatgataacaggagcagcgcagatggac
ggagcgatactagtagtatcagcagcagatggtccaatgccgcagacaagagagcacatc
ctgttagcaaggcaggtaggagtaccatacattgtagtattcctaaacaaagcagacatg
gtagatgatgaagaattaatcgaactagtagagatggaagtaagagaactattaaacgaa
tatgaattcccaggagacgacacaccgatagtagtaggttcagcattaaaagcaatggaa
tgcggatgtggacaaagagactgtcagtggtgcggcaagatatgggaattaatggatgta
gttgacagttatataccgacaccagaaagagacgtagacaagccattcctgatgccagta
gaagatgtattcacaataacaggaagagggacagtagcaacaggaagagtagagagaggc
aaattaaaagtaggagacgaagtagagataataggcttatcagacgaaagcaagaagaca
gtagtaacaggagtagagatgttcaggaagacattggacgaagcagaagcaggagataac
ataggagtactgttaagaggagtaacaagagatgaagtagagagagggcaagtactggcg
aaaccagggtcagtaaaaccgcacacgaaatttgaaggacaagtatacgtgttaacaaag
gaagaaggcggaagacatacaccgttcttcaatggatacagaccacagttctacttcagg
acaacagacgtaacaggagtaatagaattaccagagggcgtagagatggtaatgcccgga
gaccatgtaacgatgacaatagaattaataacaccgatagcaatggaagaaggattaaaa
tttgctataagggaaggcggacacacagtaggagccggtgttgtttccaagattctgtca
taa

DBGET integrated database retrieval system