KEGG   Thermoanaerobacterium thermosaccharolyticum DSM 571: Tthe_0704Help
Entry
Tthe_0704         CDS       T01299                                 

Definition
(GenBank) ATP dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
ttm  Thermoanaerobacterium thermosaccharolyticum DSM 571
Pathway
ttm03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:ttm00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    Tthe_0704
Enzymes [BR:ttm01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Tthe_0704
DNA repair and recombination proteins [BR:ttm03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     Tthe_0704
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C mRNA_cap_enzyme
Motif
Other DBs
NCBI-ProteinID: ADL68259
JGI: Tthe_0704
UniProt: D9TTK2
LinkDB All DBs
Position
complement(723491..724414)
Genome map
AA seq 307 aa AA seqDB search
MSMMDEKIPPMLAVSGQVFDDPDWLYEIKWDGSRTLAFLSSTTRLQDRRLVDVSHQFPEL
MKLNKFIRANEAILDGELIVLKDNKPSYRSIMMRKHQQNKLKIDFMSKSYPAIFITWDIL
YVDGKELLNRPLIERKQMLNKFVNECSIMRISDFIFEHGKTLFEETDKKRLEGVMAKKAD
SKYYLGKRSSLWQKFKHHIVLNAVILGYRIDKTALVLGLYNEEDKLIHIGNVESGISQKE
LSSFLDVANDLKVNPEFYGLGINNVQWIMPLIVCKVKFMEWSENFKMRAPSFLEFALDVK
PTECRFM
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgtccatgatggatgaaaaaattccacctatgctggcagtatcaggccaagtatttgat
gacccagattggctgtatgagataaaatgggatggttcaaggactctggcattcctttca
tctacaacgagactgcaggatagaagacttgtggatgtaagtcatcaatttccagaactc
atgaagctaaacaaatttatcagggctaatgaagcaatacttgatggtgaattaatagtc
ttaaaagacaataagccaagttatagaagcataatgatgcgcaaacaccagcaaaacaaa
ctaaaaatagattttatgagcaagtcttatcctgccatatttattacttgggatatactt
tatgttgatggaaaagagcttttgaatcggccgttaattgagcgaaagcaaatgttaaat
aaatttgtaaatgaatgcagcataatgcgaatatcagactttatatttgaacatggtaag
actttatttgaagaaactgataaaaaacgactggaaggtgttatggccaaaaaagcagac
tcaaaatattacttaggaaaaagaagtagtctgtggcaaaaattcaaacaccacatagta
ctaaatgctgtaatattaggttataggatagacaaaactgcgttagttttaggcctttac
aacgaggaagacaaacttatacacattggtaatgtagaatctggaatatcgcaaaaagaa
ttatcatcgtttttagatgtcgccaatgatctgaaggtcaaccctgaattttacggtctt
ggcattaacaacgtccagtggattatgccactaattgtatgtaaagttaaatttatggag
tggtcagagaatttcaaaatgagagcaccatctttcttagaatttgccttagatgtgaaa
cctaccgaatgcagattcatgtaa

DBGET integrated database retrieval system