KEGG   Thielavia terrestris: THITE_2080045Help
Entry
THITE_2080045     CDS       T02228                                 

Definition
(RefSeq) hypothetical protein
  KO
K10777  
DNA ligase 4 [EC:6.5.1.1]
Organism
ttt  Thielavia terrestris
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:ttt00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    THITE_2080045
Enzymes [BR:ttt01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     THITE_2080045
DNA repair and recombination proteins [BR:ttt03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA Ligase 4 complex
     THITE_2080045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
4:complement(join(1995256..1998271,1998337..1998443))
Genome map
AA seq 1040 aa AA seqDB search
MSSRTKRAKSPDVDAIEEDEKQYGSGPLTLEELDEQFPNRPRNHSKTPPFSDLFQSLFNP
LIDCKPSTAGAASAPARARARARAGPSFSSSSSSTKLSYHEQRRHIIERFMARWRADVGP
DFYPAMRLILPDKDRDRGVYGLKENTIGKLLVKVMKIDRNSEDGYALMHWKLPGHAGGGG
GRFGGGAGGGGGGGSRGSAGDFAGRCFEIVSKRQMRTEPGNFTIGEVNVMLDRLAGASGE
AEQLPIFEEFYQGMNAEELMWLVRIILKDMKVGATERTFLGLWHPDAEALFSVSSSLRRV
CWELYDPEFRLEQQETGVTLMSCFQPQLAQFQMTTTFAKLVANLGVTEENPEFWIEEKLD
GERMQMHMQEDDSVPGGYRFAFWSRKAKDYTYLYGSGLEDDNSALTRHLKNAFHSGVRNL
ILDGEMITWDPEVDKIVPFGTLKTAALEQQKNPFQNGPRPLYRVFDILLLNDKSLTEYTL
ADRHRALERAVKGEPRRLEIHPYETATSADAIEPLLRKVVAEASEGLVLKNPRSRYQLNS
RNNDWIKVKPEYMSEFGESLDCVVIGGYYGSGRRGGTLSSFLCGVRVSENFVKSGAAASR
EKCLSFCKVGGGFKAEDYGEIRHHTEGKWRDWDAANPPSEFIELGGGERLQYERPDVWIR
PSESVVLSVKAASFAPSDQFATGWTLRFPRFRKLRLDKAWDAAMDVDECEALRTKVKQEE
KERKAMEMESRKRRPTKRQKRELVIAGAADPAATAATATATAEFLDVKTPRSELFRGLDF
CVLSEMLRPRKMTKPELEKLLKENGGRIHQTVDKGSGMILLADKNVVKVASLKKAGDADI
VRPKWVLDCLEQGGGEGYLLPFEEGHLLFATEEMRRVAEENTDQYGDSYARDVGIDELRA
ILDAMDMPDGGGAEFDVSQFLDQLEEHGNGLEDLKSFMFRRCRMYFALGDGVPETTALRL
GNYVKFGSGEVADGVEDEKITHVVVVGGEQDTAASEKVLAADVRYRVSSRRAVPRIVSSR
WVEDCWKEGTLVDEEAYAPN
NT seq 3123 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcagaaccaagcgcgccaagtccccggacgttgacgcgatagaagaagatgag
aagcaatatggcagcggcccgctcacgctggaagagctcgatgaacagttccccaaccgc
ccacgcaaccactccaaaacaccgcccttctccgacctcttccagtccctcttcaacccc
ctgatagactgcaagccgagcacggcgggcgcggcctcggcgcccgcccgcgcccgcgcc
cgcgcccgcgccgggccctccttttcctcctcctcgtcctccaccaagctatcctaccac
gagcagcgccggcacatcatcgagcgcttcatggcgcgctggcgcgccgacgtcggcccg
gacttctacccggccatgcgcctcatcctgccggacaaggaccgcgaccgcggcgtctac
ggcctcaaggagaacaccatcggcaagctgctcgtcaaggtcatgaagattgaccgcaac
tcggaggacggctacgcgctgatgcactggaagctgcccggccatgccgggggtggtggc
ggcaggtttggcggtggtgctgggggtggtgggggtggcgggagtagggggagtgcgggc
gactttgcggggcggtgttttgagatcgtgagcaagcggcagatgaggaccgagccgggg
aattttacgattggggaggtgaatgtgatgctggatcggctggctggggccagtggcgaa
gccgagcagctgccgatattcgaggagttctatcaggggatgaatgcggaggagctgatg
tggctggtgaggattatcctgaaggatatgaaagtcggcgcgaccgagcggacgttcctt
gggctgtggcatcccgacgccgaggcgctgtttagtgtctcgtcgagcttgaggcgggtg
tgctgggagctttatgaccccgagttccggctggagcagcaggagacgggcgtcacgctc
atgtcgtgcttccagccgcagctggcgcagttccagatgacgaccacattcgcgaagctg
gtcgcgaacttgggcgtcacggaggagaatcccgagttctggatcgaggagaagctggac
ggggagaggatgcagatgcacatgcaggaggacgacagcgtcccgggcggctataggttt
gccttctggtcgcgcaaggccaaggactacacgtacctgtacggcagcgggctagaagac
gacaactcggcgctcacgaggcatctcaagaacgccttccatagcggggttcgcaacctg
atcctcgacggcgagatgatcacttgggaccccgaggtcgacaagatcgtgcccttcggc
accctcaagacggctgcgctcgagcagcagaagaacccttttcaaaacggcccgcggccg
ctgtaccgcgtcttcgacatcctcctgctcaacgacaagtccctcacagaatacaccctc
gccgatcggcaccgcgccctcgagcgcgccgtcaaaggcgagccccgccggctggaaatc
cacccctacgagaccgccacctcggccgacgcgatcgagccgctcctccgcaaagtggtc
gccgaggcctccgagggcctggtcctcaagaacccgcggtcccggtaccagctcaacagc
cgcaacaacgactggatcaaggtcaagcccgagtacatgtccgagttcggcgagtcgctt
gactgcgtcgtcatcggcggctactacggctcgggccggcgcggcggcacgctgtcgtcc
ttcctgtgcggcgtgcgcgtcagcgagaacttcgtcaagtccggcgcggcggccagccgc
gagaagtgcctcagcttctgcaaggtcggcggcggcttcaaggcggaggactacggcgag
atccggcaccacacggagggcaagtggcgcgactgggatgcggcgaacccgccgtccgag
ttcatcgagctcggcggcggcgagcggctgcagtacgagcggccggacgtgtggatccgc
cccagcgagtcggtcgtgctctcggtcaaggccgcctcgttcgcgccgtcggaccagttc
gccaccggctggaccctgcgcttcccgcgcttccgcaagctgcgcctcgacaaggcctgg
gacgccgccatggacgtcgacgagtgcgaggccctgcgcaccaaggtcaagcaggaggag
aaggagcgcaaggcgatggagatggagagccgcaagcgccggccgaccaagaggcagaag
cgggagctggtcatcgcgggcgcggcggacccggcggcgacggcggcgacggcgacggcg
acggccgagttcctggacgtcaagacaccgcgcagcgagctgttccgcgggctggacttc
tgcgtgctgtccgagatgctcaggccgaggaagatgaccaagccggagctggagaagctg
ctcaaggagaacggcggcaggatccaccagacggtggacaaggggtccggcatgatcctc
ctggcggacaagaacgtcgtcaaggtggccagcctcaagaaggccggcgacgccgacatt
gtgcgccccaagtgggtgctcgactgtctggagcagggcggcggcgagggctatctgctt
ccgttcgaggagggccacctgctcttcgccaccgaggagatgaggcgggtcgccgaggag
aacacggatcagtacggggacagctacgcgcgagacgtcgggatcgacgagctgagggcg
atcctggacgcgatggacatgcccgacggcggcggagccgagtttgacgtcagccagttc
ttggaccagctggaggagcacggcaacggcttggaggacctcaagagcttcatgtttagg
aggtgccgcatgtactttgcgcttggggatggcgtgcccgagacgacagcgctcaggctg
ggcaattacgtgaagtttgggagcggcgaggtggcggacggtgtggaggacgagaagatc
actcacgtggtcgtcgtcggcggggagcaggacacggcggcttcggaaaaggtgctggcg
gcggatgtgaggtacagggtcagctcgaggagagcggtgccgcgcattgtctcgtcgagg
tgggtcgaggactgctggaaggagggtacgcttgtggacgaggaggcgtatgcgcctaac
tag

DBGET integrated database retrieval system