KEGG   Thielavia terrestris: THITE_2114845Help
Entry
THITE_2114845     CDS       T02228                                 

Definition
(RefSeq) hypothetical protein
  KO
K11419  
histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
ttt  Thielavia terrestris
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:ttt00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    THITE_2114845
Enzymes [BR:ttt01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     THITE_2114845
Chromosome [BR:ttt03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     THITE_2114845
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    THITE_2114845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
2:join(6396968..6397015,6397066..6398034)
Genome map
AA seq 338 aa AA seqDB search
MEAAMKPHFFNHGRPDSDPKEMENCHWCQIRSFKTHKTIPITIVNEVDDEVLNPNFRFID
HSVITDDIPVADDSFKTGCNCASDEDCMYSTCQCLEEMATDSDEDEDEDEDDSSRNPGRR
KRFAYHSSGPKAGLLRSRILQSREPIYECHKLCSCSPQCPNRVVERGRTVPLQIFRTKDR
GWGVRCPVDLKKGQFVDRYLGEIITRKEADRRRAEATLAERKDVYLFALDKFENANSDDP
LLAEPPEVDGEWMSGPTRFINHSCEPNMRIFARVGDRADKHLHDLALFAIQDIPAGEELT
FDYVDGLEELDSDAHDSSKQKDMTKCLCGTKSCRGYLW
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atggaggctgctatgaagccgcatttcttcaaccatgggcggccagactccgacccgaaa
gaaatggagaactgccactggtgccagattcgctcattcaagacgcacaaaacgatacca
atcaccattgtcaatgaggtcgacgacgaggtcttgaatcccaacttccgattcatcgac
cactccgtcatcaccgacgacatccccgtggccgacgactcgttcaagacgggatgcaat
tgcgccagcgacgaggattgcatgtacagcacgtgccaatgcctcgaggagatggcgacc
gacagcgacgaggacgaggacgaggacgaggacgacagttcaagaaacccggggcggcgc
aagcgcttcgcatatcactcgagcgggcccaaggcgggtttgctgaggagtaggatcctg
cagagccgcgagccaatctacgagtgccacaagctctgctcctgctcgccccagtgcccg
aaccgagtggtggagcgaggccgaaccgtgccgctgcagatcttccggaccaaggaccga
ggctggggcgtcaggtgccccgtcgacctcaagaaaggccagttcgtggacagatacctc
ggcgagatcatcaccaggaaggaggccgatcggcgcagggccgaggcgaccctggccgaa
cgcaaggacgtgtatctctttgcgctcgacaagttcgagaacgcgaattcggacgatccg
ctgctggccgagccgcccgaggtggacggcgagtggatgagcgggccgacgcgcttcatc
aaccacagctgcgagccgaacatgcgcatctttgcgcgggtcggcgaccgcgcggacaag
cacctccacgacctggcgctgttcgccatccaggatatcccggcgggcgaagaattgact
tttgactatgtcgatggactggaggagctggacagcgacgctcacgattcgtcaaagcaa
aaggacatgaccaagtgtctgtgtgggaccaagtcgtgtagggggtacttgtggtga

DBGET integrated database retrieval system