KEGG   Thielavia terrestris: THITE_2124608Help
Entry
THITE_2124608     CDS       T02228                                 

Definition
(RefSeq) hypothetical protein
  KO
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
ttt  Thielavia terrestris
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ttt00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    THITE_2124608
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    THITE_2124608
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    THITE_2124608
   00430 Taurine and hypotaurine metabolism
    THITE_2124608
Enzymes [BR:ttt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     THITE_2124608
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
6:join(2806309..2806553,2806629..2806656,2806718..2807338,2807425..2808033,2808109..2808162)
Genome map
AA seq 518 aa AA seqDB search
MVHLSTVTHKDEGSVNKLAEGVKKVHLQLANDDDNFTTSVYGSKFAAQDLPRHEMPEHEM
PKEVAYRMIKDELSLDGNPMLNLASFVTTYMEEEAEKLMAESFSKNFIDYEEYPQSADIQ
NRCVSMIGRLFNAPVGAGETVGAVGTSCVGSSEAIMLAVLAMKKRWKNKRMAEGKPCDKP
NIVMSSAVQVCWEKATRYFEIEEKLVYCTEDRYVIDPEETVNLVDENTIGICCILGTTYT
GEYEDVKAVNDLLCKKGLTTPIHVDAASGGFVAPFVVPDLEWDFRLERVVSINVSGHKYG
LVYPGVGWVVWRSAEYLPQELVFNINYLGADQASFTLNFSKGASQVIGQYYQLIRLGKHG
YRAIMSNLTRTADYLSDSLEALGFIIMSKKSGEGLPLVAFRLPPQEGRNYDEFDLGHHLR
VRGWVVPAYTMAPHTNNLKMLRVVVREDFTKNRCDNLINDIKQCQQLLEKMDAESIKRQQ
EFIHKHHTASGKASHNHPKYRREKHSLQGKTGKTHAIC
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atggtgcacctttccaccgtcacgcacaaggacgaggggtccgtcaacaagctcgccgaa
ggcgtcaagaaagtgcacctgcagctggccaacgatgacgacaacttcaccaccagcgtc
tatggctccaagttcgccgcccaggacctcccgcgccacgagatgcccgaacacgagatg
cccaaggaggtggcttaccgcatgatcaaggacgagctgagcctggacggcaaccccatg
ctgaacctggcttcgtttgtcaccacgtacatggaagaggaagccgagaagctcatggcc
gagtcgttctccaagaacttcatcgactacgaggagtacccccagtccgccgatatccag
aaccgctgcgtctccatgatcggccgcctcttcaacgcgcccgtcggagccggcgagacg
gtcggcgccgtcggcacgtcgtgcgtcggcagctccgaggccatcatgctggccgtgctg
gccatgaaaaagcgctggaagaacaagaggatggcggagggcaagccgtgcgacaagccc
aacattgtcatgtcgtcggcagtgcaggtctgctgggagaaggcgactcggtacttcgag
attgaggagaagctcgtctactgcaccgaggaccgctacgtcatcgaccctgaggagacg
gtcaacctagtggacgagaacacgatcggcatctgctgcatcctcggcacaacctacacg
ggcgagtacgaggacgtcaaggcggtcaacgacctgctgtgcaagaagggcctgaccacg
ccgatccacgtcgacgccgccagcggtggcttcgtggcgcccttcgtcgtgccggacctc
gagtgggacttcaggttggagcgtgtggtgtcgatcaatgtctccgggcacaagtatggc
ctcgtctaccccggtgtcggctgggtcgtctggcgcagcgccgagtacctgccacaggag
ctcgtcttcaacatcaactacctcggcgccgaccaagcttcgttcacgctgaacttcagc
aagggcgctagccaggtcatcggccagtactaccagctgatccggctcggtaagcacggc
taccgcgccatcatgagcaacctcacgcgcacggccgactacctctccgactcgctcgag
gcgctcggcttcatcatcatgtccaagaagtcgggcgagggcctcccgctggtggccttc
cggctgccgccgcaggaagggcgcaactacgacgagttcgacctcgggcaccatctgcgc
gtgcgcggctgggtggtgccggcctacacgatggcgccgcacaccaacaacctcaagatg
ctgcgggtggtggtgcgcgaggacttcaccaagaaccggtgcgacaacctgatcaacgac
attaagcagtgtcagcagctgctcgagaaaatggacgccgagagcatcaagcggcagcag
gagttcatccacaagcaccacacggccagcggcaaggcctcgcacaaccaccccaagtac
cggagggagaagcactcgctccagggcaagacgggcaagacgcacgccatctgctaa

DBGET integrated database retrieval system