KEGG   Tumebacillus sp. AR23208: CBW65_11545Help
Entry
CBW65_11545       CDS       T04874                                 

Definition
(GenBank) hypothetical protein
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
tum  Tumebacillus sp. AR23208
Brite
Enzymes [BR:tum01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CBW65_11545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(2431202..2431777)
Genome map
AA seq 191 aa AA seqDB search
MKGISAKTMQEHYKLYEGYVNKANETREKLAAIDVSKGNTTYSEVRALKRGESYALNGVK
LHELYFEQLTGAGGSPGPDLQKGINRAFGSYERFLAELKGSALSARGWAILAYDTDAKEL
FIYITDDQHDGHVIHAVPILPLDVFEHAYFIDYGTKRADYIQAFLHNLDWTIIAKRYAQV
VKQGPRLKIFG
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaggcatctcggccaaaacgatgcaggaacattacaagctgtatgagggctatgta
aataaagccaacgagacccgcgagaagctcgccgcgatcgatgtttccaaaggcaacacc
acctacagcgaagtgcgggcgctcaagcgcggggaaagctacgcgcttaacggcgtgaag
ctgcacgaactgtatttcgaacagctgaccggcgccggcggcagtcccggtccggatctg
caaaaaggtatcaatcgggcgttcggcagctacgagcgcttcctcgccgagctgaaaggt
tcggccttgtccgcgcggggctgggcgattctcgcctatgacaccgatgcaaaggaactg
ttcatctacatcaccgacgaccagcatgacggacatgtcatccatgccgtgccgattctg
ccgctcgatgtttttgagcatgcctatttcatcgactacggcaccaagcgggccgactac
atccaggcgtttttgcacaatctggactggacgatcatcgccaagcgttatgcgcaagtc
gtcaaacaagggccgcgcttgaagatcttcggctag

DBGET integrated database retrieval system