KEGG   Tupaia chinensis (Chinese tree shrew): 102478264Help
Entry
102478264         CDS       T02978                                 

Gene name
PTGS2
Definition
(RefSeq) prostaglandin-endoperoxide synthase 2
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup00590  Arachidonic acid metabolism
tup01100  Metabolic pathways
tup04064  NF-kappa B signaling pathway
tup04370  VEGF signaling pathway
tup04625  C-type lectin receptor signaling pathway
tup04657  IL-17 signaling pathway
tup04668  TNF signaling pathway
tup04723  Retrograde endocannabinoid signaling
tup04726  Serotonergic synapse
tup04913  Ovarian steroidogenesis
tup04921  Oxytocin signaling pathway
tup04923  Regulation of lipolysis in adipocytes
tup05140  Leishmaniasis
tup05165  Human papillomavirus infection
tup05167  Kaposi's sarcoma-associated herpesvirus infection
tup05200  Pathways in cancer
tup05204  Chemical carcinogenesis
tup05206  MicroRNAs in cancer
tup05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:tup00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    102478264 (PTGS2)
 Environmental Information Processing
  Signal transduction
   04370 VEGF signaling pathway
    102478264 (PTGS2)
   04064 NF-kappa B signaling pathway
    102478264 (PTGS2)
   04668 TNF signaling pathway
    102478264 (PTGS2)
 Organismal Systems
  Immune system
   04625 C-type lectin receptor signaling pathway
    102478264 (PTGS2)
   04657 IL-17 signaling pathway
    102478264 (PTGS2)
  Endocrine system
   04923 Regulation of lipolysis in adipocyte
    102478264 (PTGS2)
   04913 Ovarian Steroidogenesis
    102478264 (PTGS2)
   04921 Oxytocin signaling pathway
    102478264 (PTGS2)
  Nervous system
   04726 Serotonergic synapse
    102478264 (PTGS2)
   04723 Retrograde endocannabinoid signaling
    102478264 (PTGS2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    102478264 (PTGS2)
   05206 MicroRNAs in cancer
    102478264 (PTGS2)
   05204 Chemical carcinogenesis
    102478264 (PTGS2)
   05222 Small cell lung cancer
    102478264 (PTGS2)
  Infectious diseases
   05167 Kaposi's sarcoma-associated herpesvirus infection
    102478264 (PTGS2)
   05165 Human papillomavirus infection
    102478264 (PTGS2)
   05140 Leishmaniasis
    102478264 (PTGS2)
Enzymes [BR:tup01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     102478264 (PTGS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF
Motif
Other DBs
NCBI-GeneID: 102478264
NCBI-ProteinID: XP_006161934
LinkDB All DBs
Position
Un
AA seq 603 aa AA seqDB search
MLARALLLCAVLALSQAANPCCSHPCQNRGVCMSVGFDQYTCDCTRTGFYGENCTTPEFL
TRIKLLLKPTPNTVHYILTHFKGIWNVINNIPFLRNAIMRYVLSSRAHLIESPPTYNLHY
GYKSWEAFSNLSYYTRALPPVADDCPTPMGVKGKKELPDSKEIGNLLRRKFIPDPQGTNM
MFTFFAQHFTHQFFKTDHKRGPAFTKGLGHGVDLNHVYGETLDRQHKLRLFKDGKLKYQI
IDGELYPPTVKDTQVEMIYPPHVPEHLRFAVGQEVFGLVPGLMMYATIWLREHNRVCDVL
KQEHPEWDDERLFQTTRLILTGETIKIVIEDYVQHLSGYHFKLKFDPELLFNQQFQYQNR
IAAEFNTLYHWHPLLPDTFQIDDQEYNFQQFVYNNSILLEHGLTQFVESFTRQIAGRVAG
GRNVSPAVQKVAKASIDQSREMKYQSLNEYRKRFSLKPYESFEELTGEKEMATELEALYG
DIDAMELYPALLVEKPRPDAIFGETMVELGAPFSLKGLMGNPICSPEYWKPSTFGGEVGF
KIINTASIQSLICNNVKGCPFTSFSVQDAQLSKTVTINASASHSRLDDINPTVLLKEQRS
TEL
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atgctcgcccgtgcgctgctgctgtgcgccgtcctcgcgctcagccaggcagcaaatccg
tgctgttcccacccttgtcaaaaccgaggtgtatgtatgagtgtgggatttgaccagtac
acgtgtgattgtacccggacgggattctatggagaaaactgcaccacgcctgaatttctg
acaaggataaagttactactgaagcccactccgaacaccgtgcactacatactgacccac
ttcaaagggatctggaacgtcatcaataacatccccttcctgcgaaatgcaataatgaga
tatgtgttgtcgtccagagcacatctgattgagagtccacccacttacaacttgcattat
ggctacaaaagctgggaagccttctcgaacctctcctactacaccagagcccttcctcct
gtggctgacgactgcccaacgcccatgggcgtgaaagggaagaaggagcttcctgattca
aaagagattgggaacctgctgagaagaaagttcatccctgatcctcaaggcacaaatatg
atgtttacattctttgctcagcacttcacccatcagtttttcaagacggatcataagcga
ggaccagctttcaccaaaggactgggccatggggtggacttaaatcatgtttatggcgaa
actctggatagacagcataagttgcgcctgttcaaggatgggaaactgaagtatcagatc
atcgacggagagctgtacccacccacagtcaaagatacccaggtagagatgatctacccg
cctcacgtccccgagcacctgcggtttgctgtgggacaggaggtcttcggtctggtgccc
ggtctgatgatgtatgccaccatctggctgcgggaacataaccgggtgtgcgacgtgctt
aagcaggaacacccagagtgggacgatgagcgtttgttccagacaaccaggctaatactg
actggagagactattaagattgtgatcgaagactatgtccagcacttgagtggctatcac
ttcaaactgaagtttgatccagagctgctgttcaaccaacagttccagtaccaaaaccga
attgctgctgagtttaacactctctaccactggcatccccttctgcctgacacctttcag
atcgatgaccaggagtacaacttccaacagtttgtctacaacaactctatcttactggaa
cacggactgacccagtttgttgagtcattcaccaggcaaattgccggcagggtggctggt
ggtcggaatgtttcccctgcggtgcaaaaagtagcaaaggcttcaatcgaccagagcaga
gagatgaagtaccagtcccttaacgagtaccgcaagcgcttttccctgaagccctatgaa
tcatttgaagaactgacaggagagaaggaaatggccacggagttggaagcactgtatggt
gacattgatgccatggagctgtatccagccctgctggtggaaaagccacgcccagacgcc
atctttggtgagaccatggtagaacttggagcgccattctccttgaaaggactgatgggt
aatcctatctgttctcctgagtactggaagcccagcaccttcggtggagaagtaggtttt
aaaatcatcaacacagcctccattcagtctctcatctgcaataacgtgaagggctgtccc
tttacttcattcagcgttcaagatgcacagctcagcaaaacggtcaccatcaacgcaagc
gcttcccactccagactagatgatatcaaccccacagtactgctaaaggaacagcgctca
accgaactgtag

DBGET integrated database retrieval system