KEGG   Tupaia chinensis (Chinese tree shrew): 102497535Help
Entry
102497535         CDS       T02978                                 

Gene name
PTGS1
Definition
(RefSeq) prostaglandin-endoperoxide synthase 1
  KO
K00509  prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup00590  Arachidonic acid metabolism
tup01100  Metabolic pathways
tup04611  Platelet activation
tup04726  Serotonergic synapse
tup04923  Regulation of lipolysis in adipocytes
Brite
KEGG Orthology (KO) [BR:tup00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    102497535 (PTGS1)
 Organismal Systems
  Immune system
   04611 Platelet activation
    102497535 (PTGS1)
  Endocrine system
   04923 Regulation of lipolysis in adipocyte
    102497535 (PTGS1)
  Nervous system
   04726 Serotonergic synapse
    102497535 (PTGS1)
Enzymes [BR:tup01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     102497535 (PTGS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase
Motif
Other DBs
NCBI-GeneID: 102497535
NCBI-ProteinID: XP_014444092
LinkDB All DBs
Position
Un
AA seq 490 aa AA seqDB search
MLMRLVLTVRSNLIPSPPTYNSAHDYISWEAFSNVSYYTRILPSVPKDCPTPMGTKGKKQ
LPDAQLLGQRFLLRRKFIPDPQGTNLMFAFFAQHFTHQFFKTSGKMGPGFTKALGHGVDL
GHIYGDSLERQYQLRLFKDGKLKYQVLDGEIFPPSVEEAPVLMHYPRGIPRQSQMAVGQE
VFGLLPGLMLYATLWLREHNRVCDLLKAEHPTWDDEQLFQTTRLILIGETIKIVIEEYVQ
QLSGYFLQLKFDPELLFRVQFQYRNRIAMEFNQLYHWHPLMPDSFKVGSQEYSYEQFLFN
TSMLVDYGVEALVDAFSRQIAGRIGGGRNMDHHVLHVAVETIKESRELRLQPFNEYRKRF
GMKPYTSFQELTGEKEMAAELEELYGDIDALEFYPGLLLEKCQPNSIFGESMIEIGAPFS
LKGLLGNPICSPEYWKPSTFGGKVGFNIVNTATLKKLVCLNTKTCPYVSFRVPESNENTE
PAVERPSTEL
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgctcatgcgcctggtcctcacagtacgctccaacctcatccccagtccccccacctac
aactcagcacacgactacatcagctgggaggccttctccaacgtgagctactacactcgg
attctgccctccgtgcccaaagactgccccacgcccatgggaaccaaagggaagaagcag
ttgccagatgcccagctgctgggccaacgcttcctgctcaggaggaagttcatacccgac
ccccagggcaccaacctcatgtttgccttctttgcacaacacttcacccaccagttcttc
aaaacttctggcaagatgggtcctggcttcaccaaggccttgggccatggcgtagacctt
ggccacatttatggagacagtctggaacgtcagtatcagctgcgactctttaaggatggg
aaactcaagtatcaggtgctggatggagagatattcccaccatcagttgaagaggcacct
gtattgatgcactatccacggggcatcccacgccagagccagatggctgtgggccaggag
gtgtttgggctacttcctgggctcatgctctatgccacactctggctgcgcgagcacaac
cgcgtgtgtgacctgctgaaggctgagcaccccacctgggatgacgagcagctcttccag
acgacccgcctcatcctcataggggagaccatcaagattgtaatcgaggagtatgtgcag
cagctgagtggctacttcttacagctgaagttcgaccctgagctgctcttcagggtccaa
ttccaataccgcaaccgcattgccatggagttcaatcagctctaccactggcacccgctc
atgcccgactccttcaaggtgggctcccaagagtacagctacgagcagttcttgttcaac
acctccatgcttgtggactatggggtcgaggccctggtggatgccttttctcgccagatt
gctggccggattggtgggggtaggaacatggaccaccatgtcctgcatgtggctgtggag
accatcaaggagtctcgagagttgcgactgcagcctttcaatgaataccgtaagaggttt
ggcatgaagccctacacctccttccaggaactcacaggagagaaagagatggcagctgag
ttggaggagttatatggagacatcgatgccttggagttctacccagggttgcttctcgaa
aagtgccaaccaaactctatctttggggagagtatgatcgagattggtgctcccttttct
cttaagggtcttctaggaaatcccatctgttctccggagtactggaagccaagcacattt
ggtggcaaggttggcttcaacattgtcaatacagccacactgaagaagctggtctgcctc
aacaccaagacctgtccctacgtttccttccgagtacctgaatccaatgagaacactgag
cctgctgtagagcggccatccacagagctctga

DBGET integrated database retrieval system