KEGG   Tetranychus urticae (two-spotted spider mite): 107371540Help
Entry
107371540         CDS       T04901                                 

Definition
(RefSeq) histone-lysine N-methyltransferase SUV420H1-like
  KO
K11429  
histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
tut  Tetranychus urticae (two-spotted spider mite)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:tut00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    107371540
Enzymes [BR:tut01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     107371540
Chromosome [BR:tut03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     107371540
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 778 aa AA seqDB search
MSHSGKQSKKKMVVGKTMANCRKTGDKGQSDTCSTYVTQQISHKNSNYSSIGLTATELCE
FDDLAITLIIDPYLGFCTHKMNTRFKPPKVSKDFLRQLVHGFKKHQNYEAAFDKLVSGDW
AHTLYHTRNERHKRLFKEHIFRFLRIFDKNSGFDIKPCYRYSAEGNVGAKLVATQKWFKN
EKIEMLVGCIAELTEKEEEEMLKPGINDFSVMYSCRKNCAQLWLGPGAFINHDCRANCKF
VSTGRDTACIKVLRNIDIGEEITCFYGEDFFGDNNCYCECETCERRKTGAFSQRKSENQE
DINPQCSQKIYSFRETDNRLNRMKQQAKKKESEETTKRRGVIGIEGGIKDNTNRSTNVKS
KAGGNSSNSSSNRNGLVRTKPVTQNNCKTSIVDQMGEESLDDRTMFTTRSGRVKRHLSTE
TRQVKCEPGVLKGVDQPHKNEILKNELKLDKKAVDSDSSDNKMDHKNSFNIAQVSTELKS
CDKPGDIASLKSELNQLNLSDFKESCEDKDKFLTRPPLRRSTRLSSSNSNPESIESHHIP
QPILPSPPSLTSDKNLSNKVPIHDYSQRNDSTNECVNHESPDLKNRQKLTLTIRLRRKTN
SNSGNSTLDDRSNISGASDTQINNSWERITYEVLPAFSRDCGDSFSPVKSPIKNRRRENR
KKTRKKKRKKNSRSSDVDPDRLEENNNSFDTNNNSLEDESRLECKNNDLNSNNLNNNYND
MNSYLSSDQAAVNKRKITTRSCRDSVVVEDVGVKRLKLRLGAEIRCIELPKTSSSKVS
NT seq 2337 nt NT seq  +upstreamnt  +downstreamnt
atgagtcactctggtaagcaatcaaaaaagaaaatggttgttggtaaaacaatggcaaat
tgtaggaaaacaggagacaagggacagtcggacacttgctcaacttatgtaactcaacaa
atctcccataaaaattctaattactcctccattggtttaactgccacagagctttgtgag
tttgatgatctagccataacccttattattgatccctatcttggcttctgtacccacaaa
atgaacacaaggtttaaaccacctaaagtatccaaagattttctcagacaattggtgcat
ggattcaagaagcaccaaaactatgaggctgcttttgataagctggtctctggagattgg
gcccacactttataccatactcgcaacgagagacataaaagattattcaaagagcatatt
ttcagatttttacggatttttgataaaaattcaggttttgatataaaaccatgctacagg
tattctgccgaaggaaatgttggagctaaactagtagctacccagaaatggtttaagaat
gaaaaaattgaaatgctcgtgggttgtatagctgaactcaccgagaaagaagaagaggaa
atgttgaaacctgggataaatgatttttcagttatgtactcttgtcgtaaaaattgtgct
caactctggcttggaccaggtgcatttataaatcatgattgtcgggctaattgtaaattt
gtatcaactggccgagataccgcatgtatcaaggtactaaggaatatagacatcggagaa
gagataacctgcttttatggagaagacttttttggagacaataactgttactgtgaatgc
gaaacatgcgaaaggcggaaaacaggcgccttttcccaaagaaaatccgaaaaccaagaa
gatattaaccctcaatgttctcaaaaaatctacagtttcagagagactgacaatagactg
aatcggatgaaacaacaagctaagaaaaaagaaagtgaagagacaaccaaaagaagaggg
gtgataggaatagaaggtggaataaaagacaacactaacaggagtacgaatgtcaaatca
aaagctggtggtaatagtagtaatagcagtagtaatagaaatggtttagtcagaactaaa
ccagttactcaaaataattgtaaaacttctattgtcgatcaaatgggcgaagaaagttta
gatgatagaacaatgtttacaactagaagtggaagagttaaaagacaccttagcactgaa
actagacaagtcaagtgtgagcccggagtattaaaaggagtcgaccaacctcataaaaat
gaaattttaaaaaatgagcttaaactggataaaaaggctgttgattcggactcttcagac
aataaaatggatcataaaaatagctttaacatcgctcaagtttctaccgaattaaaatca
tgtgataaaccaggtgacattgctagcttgaaaagtgaattaaatcaactaaacttatct
gatttcaaggaatcctgtgaagataaagataagtttttaacaagaccacctttacgccga
tcaactcgattatcaagtagcaattctaatcccgaatcaattgaatctcatcacatacca
cagcctatacttcctagcccaccatctttaacctccgataaaaacttgtcaaataaagtt
ccaattcatgactatagccaaagaaatgattcaaccaacgaatgtgtaaaccatgaaagt
cccgacttaaaaaacagacagaagcttacattgaccatcagacttcgacgcaaaacaaac
agtaatagtggtaattcaacattagacgatcgctctaacatatctggagctagcgatact
caaattaacaatagctgggaaagaataacttatgaagttttacctgccttttcaagagat
tgtggcgattctttttcgccagttaagagcccgataaaaaaccgtcgacgggaaaatcgt
aaaaagacaaggaaaaagaaacggaaaaagaattcccgatcatctgatgttgaccctgat
agactggaagagaataataattcattcgataccaataataattcgcttgaggatgaaagt
cgattggagtgtaaaaacaatgacctcaatagtaataatctaaacaataattataacgac
atgaactcctatttatctagtgatcaggctgctgttaacaaaaggaaaataaccactcgg
agttgccgtgattcggtggttgttgaagatgtcggagttaaacgacttaaacttcgctta
ggtgctgaaataagatgtatagaattacctaaaacatcatcatccaaagtctcatag

DBGET integrated database retrieval system