KEGG   Trichophyton verrucosum: TRV_01433Help
Entry
TRV_01433         CDS       T01615                                 

Definition
(RefSeq) hexokinase, putative
  KO
K00844  
hexokinase [EC:2.7.1.1]
Organism
tve  Trichophyton verrucosum
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:tve00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TRV_01433
   00051 Fructose and mannose metabolism
    TRV_01433
   00052 Galactose metabolism
    TRV_01433
   00500 Starch and sucrose metabolism
    TRV_01433
   00520 Amino sugar and nucleotide sugar metabolism
    TRV_01433
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    TRV_01433
Enzymes [BR:tve01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     TRV_01433
Membrane trafficking [BR:tve04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    TRV_01433
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
AA seq 568 aa AA seqDB search
MYTSLSVVYDPLSSAPFLMSAVRLPVVFFASSSSSSSFAPPLSLLSNKSPTKAKTSPPLP
LPTTTTTTTTTATTANVIPISSYNIRPRDRSMVDMPKALLDEIKELEETFTVDTARLKKI
VDHFVNELTKGLSVEGGNIPMNVTWVLGFPTGNEQGTFLALDMGGTNLRVCEIVLSEEKG
EFDITQSKYRIPEELKTGTSEELWEYIADCVQQFIEYHHDGEELPDLPLGFTFSYPATQD
YIDHGVLQRWTKGFDIDGVEGEDVVPMLESALEKKGLSIKVAALINDTTGTLIASSYTDP
EMKIGCIFGTGVNAAYMDNAGSIPKIAHYNLPPDMPVAINCEYGAFDNERVVLPLTKFDK
IIDRDSPRPGQQAFEKMTAGLYLGEIFRLVLIDIIDNKGGIIFQGQKIDNLRKPYFLDSS
FLSAIEEDPFENLSETRDLFERVLGIQATKPELELCRRLAELIGTRAARISACGVAAICK
KKNIQSCHVGADGSVFNKYPHFKQRGAKALREILDWADNEDDKVIMSSAEDGSGVGAALI
AALTLERVKAGNLAGVRNKENISQMLKG
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atgtatacatctctctctgtagtctatgatccattatcttctgcgccttttttaatgtct
gctgtccgtctccctgtcgtcttctttgcttcttcttcttcctcctccagcttcgctccc
cctttgtctctgctgagtaacaaaagcccaaccaaggccaaaacctccccaccacttccg
ctgccaactacaactacaactacaaccactacagctacaactgccaacgtcatccccatc
tccagctacaacattcgacccagagacagatccatggtcgacatgcccaaggcgctgctg
gacgagatcaaggagctcgaagagaccttcacagtcgacacggccaggctcaagaagatt
gtcgaccacttcgtcaacgagctcactaagggcctcagcgttgagggcggcaatatcccg
atgaacgttacctgggtactcggattccctaccggcaatgaacagggtaccttcctggcc
ctcgacatgggtggcaccaacctgcgagtctgcgagattgtcctctctgaggagaaggga
gagttcgacatcacccagtcaaagtaccgtatccccgaggagctgaagactggaacctct
gaggagctctgggagtacattgccgactgtgtccagcagttcattgaataccaccacgac
ggagaggagctgccagacctcccactgggcttcaccttctcttaccccgcaacacaggac
tacatcgaccacggagtcctgcagagatggaccaagggattcgatatcgacggtgttgaa
ggagaggacgtcgtccccatgcttgagagtgcattggagaagaagggattgtctatcaaa
gtcgcagctttgatcaatgacactaccggaacgctgattgcttcctcatacaccgatcct
gagatgaagattggctgtatcttcggaactggtgtcaatgccgcatacatggacaacgcg
ggctcgatacccaagattgcccattacaacctgcccccagacatgcccgtcgccattaac
tgcgagtacggcgccttcgacaacgagcgtgttgtcctgcccctgaccaagttcgacaag
atcattgaccgtgactctcctcgtcccggccagcaggcatttgagaagatgaccgctggt
ctctacctaggtgaaatcttccgtctcgtcttgatcgatatcatcgacaacaagggcggc
attatcttccagggccagaagatcgacaatctccgaaagccatacttcctcgactcttcc
ttcctctctgccattgaggaggatccgttcgagaacttgtctgaaacccgcgacctgttc
gagcgtgtccttggaatccaggctaccaagccagagctcgaactgtgcagacgtctggcc
gaacttatcggcactagagctgcacgtatctctgcctgcggtgtagctgccatctgcaag
aagaagaacatccagtcctgccatgttggtgctgacggttctgtcttcaacaagtacccc
catttcaagcagcgaggtgccaaggcccttcgtgagatccttgactgggccgataacgag
gacgacaaggttatcatgagctccgccgaggacggttccggtgttggagctgctctcatt
gctgccctgaccctcgagcgtgtcaaggctggcaacttggctggtgtccggaacaaggag
aacataagccagatgctcaagggttag

DBGET integrated database retrieval system