KEGG   Trichophyton verrucosum: TRV_03860Help
Entry
TRV_03860         CDS       T01615                                 

Definition
(RefSeq) hypothetical protein
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
tve  Trichophyton verrucosum
Pathway
tve00250  Alanine, aspartate and glutamate metabolism
tve00410  beta-Alanine metabolism
tve00430  Taurine and hypotaurine metabolism
tve00650  Butanoate metabolism
tve01100  Metabolic pathways
tve01110  Biosynthesis of secondary metabolites
Module
tve_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:tve00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    TRV_03860
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    TRV_03860
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    TRV_03860
   00430 Taurine and hypotaurine metabolism
    TRV_03860
Enzymes [BR:tve01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     TRV_03860
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase SepSecS
Motif
Other DBs
NCBI-GeneID: 9578927
NCBI-ProteinID: XP_003022043
UniProt: D4D9R7
LinkDB All DBs
AA seq 546 aa AA seqDB search
MERPEEVRKERVVGFVEQADRASQVPGQKNNDDSRPKILDFKPPEELKAVFSEGLTSSGQ
GHDGLVRTVDDLLKYSVNTWQQGFLDKLYSSPNAPGLAAELLLGTLNANVHVYQSAPALT
VIEKVTTRRFAELFGLTGPNAGGISVQGGSASNTTAIVVARNTLFPDTKKNGTGDHRFVI
FTSAHGHYSIEKAAQMIGLGSNAVHCVPVDREGRMIPQKLDEEIQKAKDDGKTPLFVNAT
AGTTVLGTFDPFTEIAGICRKHKIWFHIDGAWGGAFIFSNRQKHKLEGSHMADSIAINPH
KMLGVPLTCSFLLGADMTQFHGSNTLPAGYLFHNDVSDGSEVWDLGDLTLQCGRRGDALK
MFLNWNYIGSSGYEERIDAASDVAVHLCNLISESPDLILLSENPPPCFQICFFYAPFKQM
VHSSDNVADEAERGKLNGEITSMIANDLIEQGFMVDYAPPAAAQVEGDGKYLRCVVNLHT
KKETVERLVEVVLQLGAKAVRKQRGLELNGDFVNSNQASVPGQRPKHPLEMGRGPQGAPA
ASDFVL
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atggagcggccagaagaagtgcggaaagaacgcgttgttggatttgttgagcaggcagat
cgcgcgtcccaggttccaggacagaagaataatgatgattctcggccaaagattctggat
tttaagccaccggaagagctcaaagcagtgtttagtgaaggcttaacaagctcaggacag
ggacatgatgggcttgttcgaactgtagatgaccttctcaagtattccgtcaacacatgg
cagcaaggatttctggacaaactttactcatcaccaaacgctcctgggttggccgcagag
ttacttcttgggacattgaatgccaatgtgcacgtctaccagtcggctccagcattgacg
gtcatcgaaaaagtgaccacaagacgatttgctgagcttttcggtcttacaggacccaac
gccggcggaatctctgtccagggagggtctgcatccaacactacagcaatcgttgtagca
aggaacactctatttcccgatactaagaagaatggaacgggtgaccatcgatttgttata
tttaccagtgcgcatgggcactacagcattgaaaaagctgcgcaaatgatcggcctagga
agcaacgcggttcactgtgtacctgtcgaccgtgaaggacgaatgattccacagaagctt
gatgaggagattcagaaagcaaaggatgatggtaaaactccactcttcgtcaatgccact
gccgggactacagttctagggacatttgatccatttacggaaatcgcggggatttgccgc
aaacataaaatctggttccacattgatggtgcttggggaggtgcttttatcttttctaac
cgccagaaacacaagcttgaagggtcgcatatggctgatagtattgccataaatcctcat
aaaatgcttggagtaccattgacttgctcgttcctattgggcgccgatatgactcaattc
cacggatcaaacacgcttcctgcaggatatctattccataacgatgtgtctgatggctcc
gaggtatgggatttgggtgatttgactttacaatgcggccgtcgaggtgatgccctgaaa
atgttcctaaactggaattacatcggctcatcaggatacgaagaacgaattgatgctgca
agtgatgtcgctgtccatctctgcaacctcatatcggagtccccggatttaattctcctt
agtgaaaatccaccaccatgctttcaaatatgtttcttctatgcgccgttcaaacagatg
gtccacagttccgacaatgtggcagatgaggcagaacgtggaaaacttaacggagagatt
acttccatgattgccaatgatctgattgaacaaggatttatggttgactatgcaccaccg
gctgcagcccaagttgaaggagacggcaaatatctcagatgtgtcgtcaatcttcacact
aagaaagaaacagtcgagcgactcgtcgaagtagttttgcaattgggtgccaaagcggtc
aggaagcagcgtggactcgagttgaacggggactttgtaaattcaaaccaggcttcagta
cctggtcagcgaccaaagcaccctcttgagatgggccgtggacctcaaggcgctccggct
gcctcagattttgtgctttga

DBGET integrated database retrieval system