KEGG   Trichophyton verrucosum: TRV_05598Help
Entry
TRV_05598         CDS       T01615                                 

Definition
(RefSeq) glutamate decarboxylase
  KO
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
tve  Trichophyton verrucosum
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:tve00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    TRV_05598
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    TRV_05598
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    TRV_05598
   00430 Taurine and hypotaurine metabolism
    TRV_05598
Enzymes [BR:tve01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     TRV_05598
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
AA seq 505 aa AA seqDB search
MVHISRVRKDSVAFPPKLLNRVDTLDLEEPQDHDFYSSVYGSRFAAEDLPTDEMPEKEMP
KEVAYRMIKDELSLDGNPMLKYVLAVVILFIYRVILADLDHVYSLASFVTTYMEDEAEKL
MTESFSKNFIDYEEYPQSADIQNRCVNMIARLFHAPVGEGEHEHDHAMGTSCIGSSEAIM
LGTLAMKKRWQNRRKAEGKDCSRPNIIMSSAVQVCWEKAARYFDIEEKFVYCTNERYVLD
PEEAVNLIDKNTIGICVILGTTYTGQYEDIKAVNDLLVEKKIDCPIHVDAASGGFVAPFV
NPSLEWDFRLEKVVSINVSGHKYGLVYPGVGWIVWRSTEYLPQELVFNINYLGANQASFT
LNFSKGASQVIGQYYQMIRLGKRGYRAIMLNLTRTADYLAASLKELGFIIMSDGKGRGLP
LVAFRLPPETAEKYDEFAIAHQLRERGWVVPAYTMAPHSEKLKLMRIVVREDFSRSRCDS
LVNDFKLALAQLEEMDKKALEKYRE
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atggttcacatatccagagtccgcaaggactcggttgcttttcctcctaagctcctcaat
cgtgtcgacaccttagatcttgaggagccgcaggaccatgatttctactccagcgtctat
ggttctcgatttgcggctgaggatctgcctactgatgaaatgccggagaaggagatgccc
aaagaggtcgcttatcgtatgatcaaggatgagctcagtctggatggcaaccccatgttg
aagtacgtcctggctgtcgttattctattcatctaccgtgttatcctggctgacttagat
catgtttatagtctagcgagtttcgttaccacatacatggaagatgaagctgaaaaactc
atgaccgagtcattcagcaagaacttcattgactatgaggaatacccccagtcagccgat
attcagaaccgctgcgtcaatatgattgcacgtctatttcatgcccccgttggagaaggt
gaacacgagcatgatcacgctatgggaacctcttgcatcggatcttccgaggctattatg
ctaggaacccttgccatgaagaaacgctggcagaatcgccggaaggcagaggggaaagat
tgctctcgccccaatatcattatgagcagtgccgtccaagtctgctgggagaaggccgcc
agatacttcgacatcgaggagaagttcgtgtactgcactaacgagagatatgtcctcgac
cctgaagaagctgttaatctgattgataaaaatacaattggtatctgcgttattctggga
accacctataccggtcagtacgaggatatcaaagcagtcaatgatcttcttgtcgagaag
aaaatagactgccctatccacgttgatgctgctagtggtggctttgtcgccccctttgtc
aaccctagtcttgaatgggatttccgccttgagaaggttgtgtctattaatgtatctgga
cacaaatatggcctggtctaccctggtgttggatggatagtctggagatccacagagtac
ctcccgcaagagctggtatttaacattaactatctcggagccaaccaggcgagcttcacc
ctcaacttctccaaaggtgcctcccaggtcattggccagtactaccaaatgatccgcctc
ggaaagagaggataccgtgctataatgcttaaccttactcgcactgcagactatctcgcg
gcctccctcaaggagcttggattcatcataatgagcgatggtaaggggcgtggtctgcca
ctcgtggccttccgtctccccccagagacagccgagaagtatgatgagttcgccatcgcc
catcaactgcgtgaacgtggctgggttgtaccggcctataccatggcccctcatagcgag
aagctgaagctcatgcgtatcgttgttcgcgaggacttcagtcgtagtcgctgtgacagc
ttggtcaatgacttcaagctcgctctcgcccagttagaagagatggacaagaaggcactg
gagaagtaccgcgagtaa

DBGET integrated database retrieval system