KEGG   Thiocystis violascens: Thivi_1799Help
Entry
Thivi_1799        CDS       T02138                                 

Definition
(GenBank) 1-acyl-sn-glycerol-3-phosphate acyltransferase
Organism
tvi  Thiocystis violascens
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1956937..1959726
Genome map
AA seq 929 aa AA seqDB search
MNDSMQAADQESRLLSILQAFARESRLPEPPEGIGLDTRLETDLGLDSLSRSELIARVEA
GLGVHLRDEALLAATARDLLGLARAGAGLTGTVAAAPTMTTRRGAGIPTEALTLPDALLW
HGERHGSRIHITYYDSDDQAHPITYADLIKGASQVAGRLKQAGLSVGGTVAIMLPTGPEY
FFGFFGILAAGGVPVPIYPPARPQQIEDHLRRHARILDNAGTTILITVPEARAVARLLRL
QVASLREIITLEGLDAEAPETNWARPDPQDIAFLQYTSGSTGDPKGVVLSHADLLANIRA
MGEAVAIGPDDVFVSWLPLYHDMGLIGAWLGSLYFGIPLISMSPLAFLARPRRWLQAIHR
HRGTLSAAPNFAYELCLARLSDAQLDGLDLGSWRRAFNGAEPVSAQTLRRFAERFAPYGL
RPDALAPVYGLAEAAVGLAFPPADLGPRIDCIDRARFASSGYALPVGCDDPEAMDVVACG
RALPGYRVRIVDETGGERPERHEGLLQFQGPSATRGYYRNPEATARLIRDGWHETGDRAY
LAGGDIHLTGRVKDLIIRGGRNLYPYEVEQALGELPGVRKGCVVAFAALDPKQGSERLVI
VAESKERDPARRRALMQRMRERATDILGLPPDEIVLAPPRSVLKTSSGKLRRGDMRARYL
AGNLLEGPSRPLWQLVRVGGSAFMSRLRRLPGTLYAGYAWTIFYLIAPWFWIATMLAPRL
HWRWTLLRFGIRLLRRLAFVRLTVMGREHIPPPGSPYVLVANHQSYLDALALIETFEQPI
RFVAKRELMRNPLVGRFLARMGTFFVDRFDLQRSGSESARIGEALAHGATLGFFPEGTFR
EQPGLLPFRMGAFAAAAQAGVPVVPVTLVGTRELMPGDRFKPRPGQAQAVIGPPLMPAGN
DWGSAVELRDAARAEIAEQLERHERTRLL
NT seq 2790 nt NT seq  +upstreamnt  +downstreamnt
atgaacgactcgatgcaagccgccgaccaggaaagtcgactcctgtccatcctgcaagcc
ttcgcgcgcgagtcgcgactgccggagccgcccgagggaatcggcctggacacccggctg
gaaacggacctggggctcgacagtctgagccgctcggaactgatcgcgcgggtcgaggcc
ggtctcggcgtccatcttcgggatgaggcgctgctggccgcgacggcgcgcgatctgctc
ggtctggcgcgcgctggcgcgggtttgacgggcacggtcgcggccgcgccgaccatgacg
acgcgtcgcggcgcgggcattccaaccgaagcgctcaccctgccagacgcgctcctctgg
cacggggagcggcacggttcccggattcacattacctattacgacagcgacgaccaagca
catcccatcacctatgccgacctgatcaagggcgcctcgcaagtggcggggcgtttgaaa
caggcgggtctgagcgtcggcggaacggtggcgatcatgctgcccacgggaccggagtat
ttcttcggtttcttcggcatcctggccgccggcggcgtgccagtgcccatttatccgccc
gcgcggccccagcagatcgaggaccatctgcgccgacacgcacggatcctcgacaacgcg
ggcacaacgatcttgatcacggtgccggaggcgcgcgcggttgcccggctcctgcggctc
caggttgcctccctgcgcgagatcatcaccctggaaggactcgacgcggaggcgccggag
acgaactgggcgcgccccgacccgcaagacatcgccttcctgcaatacacctcgggcagt
accggcgatcccaagggcgtggtgctctcccacgcggatctgctggccaacatccgcgcc
atgggcgaggcggtcgcgatcggcccggacgatgtcttcgtcagttggctaccgctctat
cacgacatggggctgatcggggcctggctcggcagtctctatttcggcattccgctgatc
tcgatgtcgcccctggcctttctggcgcgtccgcggcgctggctgcaggcgattcaccga
catcgcggcaccctctcggcagcacccaactttgcctacgaactctgtctggcgcgtctc
tccgatgcgcaactggatgggctggatcttggcagttggcggcgcgccttcaatggcgcc
gagccggtcagcgcccagaccctgcgccgtttcgccgagcgtttcgcaccctatgggctg
cggcccgatgcgctggcgcccgtctatggtctggcggaggcggcggttgggctggccttt
ccaccggcggatctcggtccacgcatcgactgtatcgaccgcgcccgtttcgccagttcc
ggttatgccctgccggttgggtgcgacgatccggaggcgatggacgtcgtcgcctgcgga
cgagcgttgccaggctatcgggttcgtatcgtcgatgaaacaggcggcgagcggcccgag
cgccatgagggactgcttcagtttcagggaccgtccgcgacccgtggctattatcgcaat
ccggaagccaccgcgcggctgatccgcgacggctggcacgagaccggcgaccgcgcctat
ctggccggcggcgacatccatctgaccggacgggtcaaggatctgatcatccgcggcggg
cgcaatctctatccctacgaggtcgaacaggccttgggcgagttgccgggcgtgcgcaag
ggctgcgtcgtcgcctttgccgcgctggacccgaaacagggcagcgaacggctggtgatc
gtggccgaaagcaaggaacgcgaccccgcgcgacgccgggcgctgatgcaacgaatgcgc
gaacgcgcgaccgacatcctcggtctgccgcccgacgagatcgtgctggccccaccgcgc
tcggtgctcaagacctccagcggcaaactgcgccgtggtgacatgcgcgcgcgctatctc
gccggcaacctcctggagggaccgtcccgcccgctctggcaactcgtgcgggtgggcggc
tcggcgttcatgagccgactgcggcgtttgcccggaaccctctatgccggttacgcctgg
acgatcttttatctcatcgccccctggttctggatcgccaccatgctcgccccgcgtctg
cactggcgctggacgctgttgcgattcgggatccgactgctgcgccgactggcgttcgtc
cgcctgacggtcatgggccgggaacacatcccaccgccgggcagcccctatgtcctggtc
gccaatcatcaaagttatctggatgcgctcgcgctcatcgaaaccttcgagcaacccatc
cgcttcgtcgccaaacgcgagctcatgcgcaacccgctggtcggacgctttctggcacgc
atgggcacttttttcgtcgaccgcttcgacctccagcgcagcggttcggagtccgcgcgg
atcggcgaggcgctggcgcacggcgcaaccctcggatttttcccggaaggcacctttcgc
gaacagccggggctgttgcccttccgcatgggcgccttcgcggcagcggcccaggcgggg
gtgccggtggttcccgtcacgctcgtcggcacacgggaactcatgccaggcgatcgtttc
aaaccgcgaccgggacaggcccaggcggtcatcggcccgccgctgatgcccgcgggcaac
gactgggggtcagccgtcgaactgcgggatgcggcaagggcggagatcgccgaacaactg
gaaagacacgaacgcacgcggcttctttag

DBGET integrated database retrieval system