KEGG   Thermoplasma volcanium: TVG0062871Help
Entry
TVG0062871        CDS       T00042                                 

Gene name
TVG0062871
Definition
(GenBank) superoxide dismutase
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
tvo  Thermoplasma volcanium
Brite
Enzymes [BR:tvo01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     TVG0062871 (TVG0062871)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
62254..62871
Genome map
AA seq 205 aa AA seqDB search
MAETWEIKEKLKPRGLEGISDVQIDNHFDVHYKGYVNKLNEIWSRLPDVDRSKANQNYSE
FRALKLEETFNYGGSFLHELYFEGLTPSHSEVPDEFKDAVAKDFGSYEKWLEDFKATGTA
FRGWAILVFDLNYGKLRNIGSDAHNVGLIWNSIAILTMDVYEHAYYVDYGAKRAPYLDAF
MKNVNWPVVLKRLEKAKKAYEAFKS
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaacctgggagataaaggaaaaattaaaaccgagaggactagaaggaatatca
gatgtacagatagacaaccacttcgatgtgcattataagggatatgtaaacaagctaaac
gagatatggtcaaggctccctgacgttgacaggagcaaggctaaccagaattatagtgag
ttcagggctcttaagctagaggagacttttaactacggaggctctttcctgcacgaactc
tactttgagggccttaccccgagtcacagcgaagtccctgacgagttcaaagatgcagta
gctaaggacttcggatcatacgaaaagtggctggaagatttcaaagctactggtacagcc
tttagaggatgggccatacttgtattcgatctcaactatggaaagcttaggaacataggc
tcagatgcgcataacgtaggcttgatatggaactcaatcgcaatactaaccatggatgtt
tacgaacatgcttactacgttgattacggcgctaagagagcaccgtaccttgacgccttc
atgaagaacgtcaactggcctgttgtgcttaagaggctagagaaggctaagaaggcttac
gaagctttcaaatcctga

DBGET integrated database retrieval system