KEGG   Thermoanaerobacter wiegelii: Thewi_2071Help
Entry
Thewi_2071        CDS       T01607                                 

Definition
(GenBank) Alanine racemase
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
twi  Thermoanaerobacter wiegelii
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:twi00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    Thewi_2071
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    Thewi_2071
Enzymes [BR:twi01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     Thewi_2071
Peptidoglycan biosynthesis and degradation proteins [BR:twi01011]
 Precursor biosynthesis
  Racemase
   Thewi_2071
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
complement(2103274..2104428)
Genome map
AA seq 384 aa AA seqDB search
MFDNIRPTRAEIYLDNIVHNLSEVKRWVGKKVKIMGVVKANAYGHGACQVAKVLIENGVS
YLAVATIEEALELRECGINIPILVIGYTPLTQAKELIVHNITQTVFDINYVKDLERIALN
VGKKAKVHVKIDTGMGRIGYTDLKVAEKEIEKMMEMEGVEVEGIFSHFATSDEKNKTYAE
KQFDMFKKLLERLKEKGINIPLKHIANSGAIIDLKYTYLDMVRPGIVLYGSYPSEEVERP
LDLKQTMGFKTKIVHIKEVPEGTSISYGRTFITKRKSKIATLPVGYADGFNRLLSNNHHV
LVKGKYAPVIGRICMDQTMIDVTDIEGVELGDDVVIFGNQEGEKITAEEIAKKLNTIPYE
VYCGISRRVPRIYIYKGEVVEVKN
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgtttgataatataaggccaacaagagcagaaatatatttggataatatagtgcataat
ttaagtgaagtaaagcgatgggtgggcaagaaagtaaaaataatgggggtagtgaaagcc
aatgcttatggtcatggagcttgtcaagtagcaaaggttttaatagaaaatggggtttct
tatttggcagtagctacaatagaagaggcgttagaattaagggaatgcggaattaatatt
cccatactcgttattggatatactcctttaactcaggccaaagaattaattgtgcacaat
ataactcaaactgtttttgatataaactatgttaaagacttagaaagaattgccttaaat
gtgggtaagaaggctaaagttcatgtaaaaattgatacaggtatgggacggataggatat
acagatttaaaggtagctgaaaaagagatagaaaaaatgatggaaatggaaggggtagag
gtagaaggcatatttagtcattttgctacttctgatgaaaaaaataaaacatatgctgaa
aaacagtttgatatgttcaaaaaattgttggaaaggttaaaagaaaaagggataaatatt
cctttaaagcatatagctaacagtggagcaattattgaccttaaatatacttatttagac
atggtaaggccaggaatagttttatacggcagttatccttcagaagaagtcgaaagacca
ttggatttaaaacaaactatgggctttaaaactaaaatagtgcatataaaagaggtacct
gaaggtacttccattagttatggaaggacatttataactaaaagaaaaagcaaaattgcc
acattgcctgtaggatatgctgatggttttaatagattactctctaataatcatcatgtc
ttagtaaaagggaaatatgctcctgtaattgggagaatttgtatggaccaaacgatgata
gatgtcaccgatatagaaggagtagaactaggtgatgatgtagttatttttggaaatcaa
gagggagaaaaaataacagcggaggagattgctaaaaaattaaatactataccttatgaa
gtatattgtggaatatctagaagggtgcctcgaatatatatttacaaaggagaggtagtt
gaagtaaaaaattaa

DBGET integrated database retrieval system