KEGG   Thalassospira xiamenensis: TH3_14885Help
Entry
TH3_14885         CDS       T03639                                 

Definition
(GenBank) glutathione S-transferase domain-containing protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
txi  Thalassospira xiamenensis
Pathway
txi00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:txi00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    TH3_14885
Enzymes [BR:txi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     TH3_14885
Transporters [BR:txi02000]
 Other Transporters
  Pores ion channels [TC:1]
   TH3_14885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_2 GST_N_3 GST_C_2 GST_C GST_C_3 GST_N_4 Tom37
Motif
Other DBs
NCBI-ProteinID: AJD53083
UniProt: A0A0B4Y380
LinkDB All DBs
Position
3255261..3255878
Genome map
AA seq 205 aa AA seqDB search
MKLHYFPLSGHAHRAHLFLSLLGVEHDVITVDLPNGAHKSPEFLKLNPLGQVPVLEDGDV
VIADSIAIMTYVAKKRGATDWLPEDAESAAKVQKWLSVAAGQIAYGVCAARLLTVFNVPF
NADEVIARAHAILAQIDDALSGKDWIELGRPTIADVALYSYIANAPEGNVDLAPYGNVRA
WLKRVEALPGFVPFEQTVAGLRKSA
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgcattattttcccctctcgggccatgcccaccgcgcccacctgtttctaagc
cttctgggcgttgagcatgatgtcataacggtcgatctgcccaatggcgcgcataaatcg
ccggaattcctcaaactgaacccgttgggtcaggtgcccgtgcttgaagatggcgacgtc
gtgattgccgattccatcgccatcatgacctatgtcgccaagaaacgcggcgcgaccgac
tggctgcccgaagatgccgaaagtgccgccaaggttcagaaatggctttcggtcgcggcg
gggcaaattgcctatggcgtctgtgctgcccgtctgctcacggtgtttaatgtaccgttc
aatgccgacgaagtcattgcacgcgcccatgccattctggcccagattgatgacgcgctt
tcgggcaaggactggatcgagctgggccgtccaaccatcgccgatgtcgccctttacagc
tatatcgccaatgcgcccgaaggcaatgttgacctcgccccctatggcaatgtgcgtgcc
tggctgaaacgggtcgaagccctgcccggtttcgtgccgttcgaacagactgtcgctggc
ctgcgcaagtcggcctga

DBGET integrated database retrieval system