Ursus americanus (American black bear): 123778302 Help Entry 123778302         CDS       T07931                                  Symbol RELA Name (RefSeq) transcription factor p65   KO K04735   transcription factor p65 Organism uar  Ursus americanus (American black bear) Pathway uar01523   Antifolate resistance uar04010   MAPK signaling pathway uar04014   Ras signaling pathway uar04024   cAMP signaling pathway uar04062   Chemokine signaling pathway uar04064   NF-kappa B signaling pathway uar04066   HIF-1 signaling pathway uar04071   Sphingolipid signaling pathway uar04137   Mitophagy - animal uar04151   PI3K-Akt signaling pathway uar04210   Apoptosis uar04211   Longevity regulating pathway uar04218   Cellular senescence uar04380   Osteoclast differentiation uar04613   Neutrophil extracellular trap formation uar04620   Toll-like receptor signaling pathway uar04621   NOD-like receptor signaling pathway uar04622   RIG-I-like receptor signaling pathway uar04623   Cytosolic DNA-sensing pathway uar04625   C-type lectin receptor signaling pathway uar04657   IL-17 signaling pathway uar04658   Th1 and Th2 cell differentiation uar04659   Th17 cell differentiation uar04660   T cell receptor signaling pathway uar04662   B cell receptor signaling pathway uar04668   TNF signaling pathway uar04722   Neurotrophin signaling pathway uar04917   Prolactin signaling pathway uar04920   Adipocytokine signaling pathway uar04926   Relaxin signaling pathway uar04931   Insulin resistance uar04932   Non-alcoholic fatty liver disease uar04933   AGE-RAGE signaling pathway in diabetic complications uar04936   Alcoholic liver disease uar05010   Alzheimer disease uar05022   Pathways of neurodegeneration - multiple diseases uar05030   Cocaine addiction uar05132   Salmonella infection uar05133   Pertussis uar05134   Legionellosis uar05135   Yersinia infection uar05140   Leishmaniasis uar05142   Chagas disease uar05145   Toxoplasmosis uar05146   Amoebiasis uar05152   Tuberculosis uar05160   Hepatitis C uar05161   Hepatitis B uar05162   Measles uar05163   Human cytomegalovirus infection uar05164   Influenza A uar05165   Human papillomavirus infection uar05166   Human T-cell leukemia virus 1 infection uar05167   Kaposi sarcoma-associated herpesvirus infection uar05168   Herpes simplex virus 1 infection uar05169   Epstein-Barr virus infection uar05170   Human immunodeficiency virus 1 infection uar05171   Coronavirus disease - COVID-19 uar05200   Pathways in cancer uar05202   Transcriptional misregulation in cancer uar05203   Viral carcinogenesis uar05207   Chemical carcinogenesis - receptor activation uar05208   Chemical carcinogenesis - reactive oxygen species uar05212   Pancreatic cancer uar05215   Prostate cancer uar05220   Chronic myeloid leukemia uar05221   Acute myeloid leukemia uar05222   Small cell lung cancer uar05235   PD-L1 expression and PD-1 checkpoint pathway in cancer uar05321   Inflammatory bowel disease uar05415   Diabetic cardiomyopathy uar05417   Lipid and atherosclerosis uar05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:uar00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     123778302 (RELA)    04014 Ras signaling pathway     123778302 (RELA)    04064 NF-kappa B signaling pathway     123778302 (RELA)    04668 TNF signaling pathway     123778302 (RELA)    04066 HIF-1 signaling pathway     123778302 (RELA)    04071 Sphingolipid signaling pathway     123778302 (RELA)    04024 cAMP signaling pathway     123778302 (RELA)    04151 PI3K-Akt signaling pathway     123778302 (RELA)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     123778302 (RELA)   09143 Cell growth and death    04210 Apoptosis     123778302 (RELA)    04218 Cellular senescence     123778302 (RELA)  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     123778302 (RELA)    04620 Toll-like receptor signaling pathway     123778302 (RELA)    04621 NOD-like receptor signaling pathway     123778302 (RELA)    04622 RIG-I-like receptor signaling pathway     123778302 (RELA)    04623 Cytosolic DNA-sensing pathway     123778302 (RELA)    04625 C-type lectin receptor signaling pathway     123778302 (RELA)    04660 T cell receptor signaling pathway     123778302 (RELA)    04658 Th1 and Th2 cell differentiation     123778302 (RELA)    04659 Th17 cell differentiation     123778302 (RELA)    04657 IL-17 signaling pathway     123778302 (RELA)    04662 B cell receptor signaling pathway     123778302 (RELA)    04062 Chemokine signaling pathway     123778302 (RELA)   09152 Endocrine system    04920 Adipocytokine signaling pathway     123778302 (RELA)    04917 Prolactin signaling pathway     123778302 (RELA)    04926 Relaxin signaling pathway     123778302 (RELA)   09156 Nervous system    04722 Neurotrophin signaling pathway     123778302 (RELA)   09158 Development and regeneration    04380 Osteoclast differentiation     123778302 (RELA)   09149 Aging    04211 Longevity regulating pathway     123778302 (RELA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     123778302 (RELA)    05202 Transcriptional misregulation in cancer     123778302 (RELA)    05207 Chemical carcinogenesis - receptor activation     123778302 (RELA)    05208 Chemical carcinogenesis - reactive oxygen species     123778302 (RELA)    05203 Viral carcinogenesis     123778302 (RELA)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     123778302 (RELA)   09162 Cancer: specific types    05212 Pancreatic cancer     123778302 (RELA)    05221 Acute myeloid leukemia     123778302 (RELA)    05220 Chronic myeloid leukemia     123778302 (RELA)    05215 Prostate cancer     123778302 (RELA)    05222 Small cell lung cancer     123778302 (RELA)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     123778302 (RELA)    05170 Human immunodeficiency virus 1 infection     123778302 (RELA)    05161 Hepatitis B     123778302 (RELA)    05160 Hepatitis C     123778302 (RELA)    05171 Coronavirus disease - COVID-19     123778302 (RELA)    05164 Influenza A     123778302 (RELA)    05162 Measles     123778302 (RELA)    05168 Herpes simplex virus 1 infection     123778302 (RELA)    05163 Human cytomegalovirus infection     123778302 (RELA)    05167 Kaposi sarcoma-associated herpesvirus infection     123778302 (RELA)    05169 Epstein-Barr virus infection     123778302 (RELA)    05165 Human papillomavirus infection     123778302 (RELA)   09171 Infectious disease: bacterial    05132 Salmonella infection     123778302 (RELA)    05135 Yersinia infection     123778302 (RELA)    05133 Pertussis     123778302 (RELA)    05134 Legionellosis     123778302 (RELA)    05152 Tuberculosis     123778302 (RELA)   09174 Infectious disease: parasitic    05146 Amoebiasis     123778302 (RELA)    05145 Toxoplasmosis     123778302 (RELA)    05140 Leishmaniasis     123778302 (RELA)    05142 Chagas disease     123778302 (RELA)   09163 Immune disease    05321 Inflammatory bowel disease     123778302 (RELA)   09164 Neurodegenerative disease    05010 Alzheimer disease     123778302 (RELA)    05022 Pathways of neurodegeneration - multiple diseases     123778302 (RELA)   09165 Substance dependence    05030 Cocaine addiction     123778302 (RELA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     123778302 (RELA)    05418 Fluid shear stress and atherosclerosis     123778302 (RELA)    05415 Diabetic cardiomyopathy     123778302 (RELA)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     123778302 (RELA)    04932 Non-alcoholic fatty liver disease     123778302 (RELA)    04931 Insulin resistance     123778302 (RELA)    04933 AGE-RAGE signaling pathway in diabetic complications     123778302 (RELA)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     123778302 (RELA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:uar03000]     123778302 (RELA) Transcription factors [BR:uar03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    RHR (Rel homology region) Rel/Ankyrin     123778302 (RELA) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  RHD_DNA_bind RHD_dimer Motif Other DBs NCBI-GeneID:  123778302 NCBI-ProteinID:  XP_045631499 LinkDB All DBs Position Unknown AA seq 539 aa AA seqDB search MDDLFPLIFPSEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPT IKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQC VKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPAGRPLRLSPVLS HPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFS QADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEE KRKRTYETFKSIMKKSPFNGPTDPRPPPRRIAVPSRSTPSVPKPAPQPYPFTPSLSTINF EEFSPMVFPSGQIPNQTSALAPAPAPILAQAPAPAPAPILAPGLAQAVVPPAPKTTQAGE GTLSEALLHLQFDADEDLGALLGNSTDPAVFTDLASVDNSEFQQLLNQGVSVAPHTAEPM LMEYPEAITRLVTGSQRPPDPAPAPLGASGLPNGLLSGDEDFSSIADMDFSALLSQISS NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt atggacgacctgtttcccctcatcttcccgtctgagcccgcccaggcctctggcccctat gtggagatcatcgagcagcccaagcagcggggcatgcgcttccgctacaagtgcgagggc cgctcagcgggcagtatcccgggcgagaggagcacggataccaccaagacccaccccacc atcaagatcaatggctacactgggccagggacagttcgcatctccctggttaccaaggac ccccctcaccggcctcacccccatgagcttgtggggaaagactgccgggatggcttctat gaggctgagctctgccccgaccgttgcatccacagcttccagaacctggggatccagtgt gtaaagaagcgggacctggagcaggccatcagtcaacgcatccagaccaacaacaatccc ttccaagttcccatcgaagaacagcgtggggactacgacctgaatgcggtgcggctgtgc ttccaggtgacagtgcgggacccggcaggcaggcccctccgcttgtcacctgtcctctct catcccatctttgacaaccgtgcccccaacaccgccgagctcaagatctgccgagtgaac cggaactctgggagctgcctcgggggggatgagatcttcctgctgtgtgacaaggtgcag aaagaggacatcgaagtgtatttcacgggaccgggctgggaggcccgaggctccttttct caagctgacgtccaccgacaagtggccattgtgttccggacacctccctacgcggacccc agcctgcaggcccccgtgcgtgtctccatgcagctgcggcggccttcagatcgggagctc agcgagcccatggaattccagtacttgccagacacagatgatcgacaccgaattgaggag aaacgcaaaaggacgtatgagaccttcaagagcatcatgaaaaagagtcctttcaatgga cccaccgacccccgacctccaccccggcgcattgctgtgccttcccgaagcacaccttcc gtccccaagccagctccccagccctatccctttacgccgtccctcagcaccatcaacttc gaggagttctcccccatggtctttccttcggggcagatcccaaaccagacctctgccttg gccccagcccctgccccaatcctcgcccaggccccggccccagcccctgccccgatctta gccccaggccttgctcaggctgtggtcccccccgcccccaagaccacccaggccggggaa gggacactgtcagaggccctgctgcacctgcagtttgacgccgacgaagacctgggggcc ctgctgggcaacagcactgaccccgccgtgttcacagacctggcatctgtcgacaactct gagtttcagcagctgctgaaccagggtgtatctgtggccccacacacagccgagcccatg ctgatggagtaccctgaggcaataacgcgcctggtgacagggtcccagaggccccctgac ccagctcctgctcccctgggggcctctgggctccccaacggcctcctctcaggggatgaa gacttctcctccattgcagacatggacttctcagcccttctgagtcagatcagctcctaa

DBGET integrated database retrieval system