KEGG   Ustilago maydis: UMAG_01009Help
Entry
UMAG_01009        CDS       T01021                                 

Definition
(RefSeq) putative glycogen (starch) synthase
  KO
K00693  
glycogen synthase [EC:2.4.1.11]
Organism
uma  Ustilago maydis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:uma00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    UMAG_01009
Enzymes [BR:uma01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     UMAG_01009
Glycosyltransferases [BR:uma01003]
 Polysaccharide
  Storage polysaccharide
   UMAG_01009
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2
AA seq 746 aa AA seqDB search
MASSSPKRDVHNPLLFEAAWEVANKVGGIYTVIKTKAPVTHQEYGERYTLIGPLSYKTAP
MEVEALEPEDPILKETLDSMRDAGVKFLYGRWLIERAPRVLLFDTSSMYHRMDEWKGDLW
NLAGIPTPPNDHETNETLVFGYLVAWFLGEFSSRDRKRAIIAHFHEWQAGLAIPLCRKRH
IDVTTIFTTHATLLGRYLCAGSVDFYNNLQYFDVDHEAGKRGIYHRYCVERAAAHCADVF
TTVSHITAYESEHLLKRKPDGVLPNGLNVVKFSAMHEFQNLHAVSKAKINEFVKGHFYGH
YDFDLDNTLYFFTAGRYEYRNKGVDMFIESLARLNYKLQKSGSKTTVVAFIIMPAATNSY
TIEALKGQAVTKQLRDTVEQIQARVGERLFEKMARYQGETGSDVIDPATLLSDADKIALK
KRIFALKRNSLPPVVTHNMQDDDNDPILNQIRRVQLFNRTSDRVKVIFHPEFLNANNPIL
GLDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGVPSITTNLSGFGCFMEDTIERGEDYG
IYIVDRRMKSVEDSVNQLTDQMFSFSQKTRRQRINQRNRTERLSELLDWKRLGLEYAKAR
QLALRRAYPDSFDEDDTIESYFDDIHHDGKMPPPLSMPGSPRFGSGARTPGEFGTLTEEL
QSLSTSDYRGHQQFWKTMSQHGSDDEEENYRYPLVIKSRARGTSVGSMSGASTPGLGGGK
FLSSADLDRADAALSNHSGAPNGHGY
NT seq 2241 nt NT seq  +upstreamnt  +downstreamnt
atggcatcttcctctcccaagagggacgtccacaacccgctcctctttgaggcagcatgg
gaagtagccaacaaggtcggtggtatctacaccgtcatcaagaccaaggcccccgtcacg
caccaggaatatggcgaacgctataccctgatcggcccgctttcctacaagacagcgccc
atggaggtcgaggcgctcgagcccgaggaccctattctcaaggagacgctcgacagcatg
cgtgatgctggtgtcaagtttctctacggacgctggctcatcgaacgtgctcctcgtgtt
ctcctttttgacacctcgagcatgtaccaccgcatggacgagtggaagggcgatctctgg
aacctcgctggtatccccacaccgcccaacgaccacgagaccaacgagacgctcgtcttt
ggttatctcgttgcatggttcctcggcgagttttcgagtcgtgaccgcaagcgtgccatc
attgcccacttccatgagtggcaggcaggtctcgccatccccctctgcaggaagcgtcac
attgacgtaaccaccatctttacaacccatgccaccctcctcggtcgatacctgtgtgca
ggcagcgtcgatttttacaacaacctccaatactttgacgtcgatcatgaggcgggtaag
cgcggcatctatcacagatactgcgtcgaacgtgctgctgcccactgcgccgacgtgttc
accaccgtcagccacattaccgcctacgaatccgagcacctcttgaaacgaaagccagac
ggtgttctccccaacggtctcaacgtcgtcaagttctccgccatgcacgagttccagaac
ctccacgctgtgtccaaggccaagatcaatgagttcgtcaagggtcacttctacggacac
tatgactttgacttggacaacacgctctactttttcaccgccggtcgatacgagtaccga
aacaagggtgtcgacatgtttatcgagtcgcttgctcgtctcaactacaagctacaaaag
agcggctccaagaccacggtggtcgccttcatcatcatgcctgccgccaccaactcgtac
accatcgaggcgctcaagggtcaggccgtcaccaagcagttgcgtgacacggtcgaacag
atccaagctcgcgtgggagagcgtctgtttgagaaaatggcccggtatcagggcgagacc
ggctccgatgtcatcgatcccgcgacactgctttcggatgcggacaagattgcgctcaag
aagcgcatcttcgccctcaagcgcaactcgctacctcccgtcgtgacacacaacatgcag
gacgacgacaatgatcccatcctcaaccagattcgccgcgttcagctgttcaaccgcacc
agcgaccgagtcaaggtgatcttccatccagaattcctcaacgcaaacaacccgatcttg
ggtctcgattacgaagagtttgtgcgaggttgccacttgggtgtcttcccatcgtactac
gagccttggggctacacacccgctgagtgcaccgtgatgggtgttccatcgatcaccacc
aacctgtctggattcggctgtttcatggaggacacgatcgagcgcggcgaggactacggc
atctacattgttgatcgacgaatgaagagcgttgaagactcggtcaaccagctcacggac
cagatgttcagtttcagtcaaaagactcgtcgacagcgtatcaaccagcgaaaccgcacc
gagcgtctgtccgagttgctcgactggaagcgtttgggtctggaatacgccaaagcacga
cagcttgcgcttcgccgtgcctacccggactcgtttgacgaggatgacactatcgaaagc
tactttgacgacattcaccacgatggcaagatgcctccaccgctctcgatgcccggttcg
ccgcgtttcggatcgggtgctagaacgcccggcgagttcggtacgctcacggaggagctg
cagagtctctcgacctccgactaccgagggcatcagcaattctggaagaccatgagccag
cacggatcagacgacgaggaggaaaattaccgctacccactggtcatcaagtcgcgtgca
cgcggaacatcggttggcagcatgagtggcgccagcaccccaggtctgggtggtgggaag
ttcctctcgagcgccgatctggatcgcgccgatgccgcgctcagcaaccacagcggtgcg
ccgaacggccacggctactga

DBGET integrated database retrieval system