KEGG   Uncinocarpus reesii: UREG_01753Help
Entry
UREG_01753        CDS       T01132                                 

Definition
(RefSeq) similar to taka-amylase
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
ure  Uncinocarpus reesii
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ure00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    UREG_01753
Enzymes [BR:ure01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     UREG_01753
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
AA seq 583 aa AA seqDB search
MLLRAALLYLLGGDFVFAGNADDWKPRSVYQILTDRFARTDGSTTAPCNAEDGITCGGTW
KGITDHLDYIQGMGFDAIMISPITKNVNGTVRYGDAYHGYWPQNLYELNHNFGTRRDLLD
LSKAVHDRGMYLMVDVVINNMAYITNGSNPAKDVDYSTFVPFNDQKYFHPYCKITNYDDY
EMAQKCWTGDKLVPLPDLNTEDAKVTQMMAAWVRGLISNYSVDGLRIDAAKHVDTDYLRN
VVKASGVFAIGEVYEKNPKIICEYQNYLPSLLNYPVYYAMIEAFSKGNMSVLVEAVEKVT
VVCKDTFVLAAFSENHDLPRFPSFKKELSLAKNVIAFTILSDGIPMYYQGQEQHFSGDGV
PENREALWLSKYNTRSPLYNFTASVNQIRRQAIRVDRDYLEHPLYPLSNENGISAFRKGH
DGRHIIVVYSRHGEDGASRSIKIPRCGHQHLEFTEITTCRNHTLDDWGALRVTVYNGLPK
IFFPANQMGGSGLCGFGDWPISGSKKKGEGKSNIDKTHWTNEIPVNPKWGRRPGREGSRP
VHRAKAKNSKKKKRPKISGSGKTWSGWPMPVLVSSLVTLHFEL
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atgctgctccgggctgcacttctctacctcttagggggtgatttcgtgtttgcgggcaac
gcggacgattggaaacccagatcggtataccagattctcacagatcgatttgcccggacg
gatggatccacaacagcaccatgcaacgcagaagacggtataacctgcggtggaacatgg
aaaggaatcacggatcatctggactatatccaggggatggggtttgacgccattatgata
tcccccattacaaagaatgtcaacggcacggttcgctatggagatgcgtaccacggctac
tggccgcaaaatctgtatgagctgaatcataattttggaacgcgtcgggatcttctcgat
ttgagcaaggctgttcacgatcgagggatgtatttgatggttgacgttgttatcaacaac
atggcatatatcacgaatggcagcaacccggctaaagatgtcgactattcaacgttcgtc
cctttcaatgatcagaagtatttccatccctactgcaagattacgaattacgatgattat
gaaatggcgcaaaaatgctggacaggtgacaaactcgtaccacttcccgatctcaacaca
gaagatgccaaagtcacgcaaatgatggctgcatgggtgaggggtctaatctccaactat
tcggtggatggtttgcgaatagatgcggcgaaacacgtggataccgactacttgaggaat
gttgtgaaagcgtcgggcgtatttgctataggggaggtttatgaaaagaacccgaagatt
atttgcgagtatcaaaattatcttccaagtctgctaaactaccctgtttactacgcgatg
attgaggccttcagcaaagggaacatgtctgtgcttgtcgaagccgtagagaaagtgacg
gttgtctgcaaggatacttttgttctcgctgctttctcggagaaccatgatctgcctaga
tttccatcctttaaaaaggagctctcacttgccaaaaatgtgattgcttttaccattctc
tcagacggaattccaatgtactatcaaggccaggaacagcatttttctggtgacggagtc
ccagaaaaccgtgaagcgctatggctgtcaaaatataatactcgatccccactttataac
ttcacagcttcagtcaaccaaatacgtcgacaggctattcgtgtagaccgcgattatctt
gaacatccactgtatccgctatctaacgagaatggcatttccgcattccgtaaagggcat
gatgggcgtcatataatcgttgtttactcgcggcatggcgaagacggagcaagccgtagc
atcaaaatcccaagatgtggacatcaacacctggaatttactgaaattactacttgccga
aatcacactcttgatgattggggtgctctccgagttacggtgtacaacggcctgcctaag
atattcttccctgcaaatcagatggggggaagcggcctgtgtggatttggagactggcct
attagtggttcgaaaaagaaaggggaagggaagtcaaatattgataaaacccactggaca
aacgaaatcccggtcaacccaaaatgggggaggcggccaggccgggaaggatccaggcca
gtgcatagggcaaaggcgaagaattccaagaagaaaaagcggccgaaaatctccggatct
ggaaagacatggagtggatggccaatgccggtgttagtatcttcattggtgacgctccat
tttgagctgtga

DBGET integrated database retrieval system