KEGG   Uncinocarpus reesii: UREG_05902Help
Entry
UREG_05902        CDS       T01132                                 

Definition
(RefSeq) hypothetical protein
  KO
K11419  
histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
ure  Uncinocarpus reesii
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:ure00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    UREG_05902
Enzymes [BR:ure01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     UREG_05902
Chromosome [BR:ure03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     UREG_05902
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    UREG_05902
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
AA seq 437 aa AA seqDB search
MVIDLTGDSTSEGEDIYHEAIKTSFNNADLLLATFKHQPKSHKTQRKLQELRIVPIQNSS
SSSEAESCVSFGSRKRRRDETDSPASSLPGHHGLSDFFLVHNTPKKVAGMYAKVKDVKRS
TTKFNRGVRTFQPPQKSRRTPLDLQNLYAKKVASINGPPVHITFNDNSRIVDFNFEFISN
YKMQEGVYPVDSNFHAGCDCIGAKCNLRSCSCLSQEEDSLERIIPYRVGDAGVIILRDEF
MRRKSMIYECSLLCNCDWNCMNKVVERGRTVRLEIFQTRNRGFGLRSADFIQAGQYIDCY
LGEVVTKVEADDREAATSNNRASYLFSLDFLVDQDDDDIYVVDGRKFGSVTRFMNHSCKP
NCQMFPVSHNHADQHIFGLAFFAVTDIPPGKELTFDYHPNWKSDGNLDIDPDAVKCLCGE
KNCRGQLWPNQRKTLHN
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atggtgatcgacttgactggagattcaacatcggagggagaggacatatatcatgaggca
attaaaacctcattcaacaacgctgacctgcttctggcgacattcaaacatcagccaaaa
agtcacaagacacaaagaaagctacaagagctcagaattgttcccatccagaattcttcg
agctcttcggaagcagagagttgtgttagcttcggcagtcgaaaacgaaggcgagatgaa
acagactcccctgcttcctcactccccggccaccatggcctttctgactttttcctggtt
cataatacccccaagaaagtcgcgggaatgtatgcaaaagtcaaggatgtgaagcggagc
acaactaaattcaatcgtggagttcgaacctttcagccaccgcagaagtcacgtcgaaca
cccttagatttgcaaaatctctatgcaaagaaagtcgcttcaatcaatgggcctccagtc
catattacatttaatgacaattcccgcattgtggactttaattttgaatttataagcaat
tacaagatgcaggaaggtgtttatcctgttgattccaacttccacgcaggctgtgactgc
attggtgcaaagtgcaacttaaggagctgctcatgcctttcacaggaggaagactccttg
gaacgaatcataccttacagagttggtgatgctggcgtcattattttgcgtgacgaattc
atgcgacgaaagtcgatgatctatgaatgctctttgttgtgtaattgtgactggaattgt
atgaacaaagttgttgagcgaggaagaactgttcgccttgaaatatttcaaacccgaaat
cgaggatttggactaaggtcggcggatttcatccaggctggtcaatacattgactgctac
cttggtgaagtggtgacgaaagtcgaggctgacgaccgtgaagctgctacctcaaataat
agagcaagctacttattttcactagactttcttgtggatcaggatgatgatgatatctat
gttgttgatgggagaaaatttggttctgttacaaggtttatgaatcattcttgcaagcca
aactgccaaatgtttccagtttctcacaaccatgctgatcaacatatatttggactggca
ttttttgctgtaactgatatcccccctggtaaagagttgacttttgactatcatcctaat
tggaaaagtgatgggaatcttgatattgacccagatgcagtgaaatgcttatgtggagag
aagaattgtcgcggtcagctttggcctaatcaaagaaaaacattgcacaattga

DBGET integrated database retrieval system