KEGG   Uncinocarpus reesii: UREG_06007Help
Entry
UREG_06007        CDS       T01132                                 

Definition
(RefSeq) glutamate decarboxylase
  KO
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
ure  Uncinocarpus reesii
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ure00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    UREG_06007
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    UREG_06007
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    UREG_06007
   00430 Taurine and hypotaurine metabolism
    UREG_06007
Enzymes [BR:ure01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     UREG_06007
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
AA seq 439 aa AA seqDB search
MASFVGTYMEREAQDLLVENMSKNLADADEYPALMDIHARCISMIANMWHPQPGEHPIGT
ATTGSSEAIQLGGLAMKRRWQEKRKAEGKDASKPNIIMGANAQVALLKFARYFDVEARIL
DVCEESHYRLDPKEVKKNVDENTIGIFVILGSTYTGHYEPVEEISNILDEVEKEHGWDIP
IHVDGASGGFIAPFTHAGAGGPKWDFNLPRVHSINVSGHKFGLVYVGLGWVIWRDRQYLP
KDLIFQLHYLGGTEESFALNFSRPGLQVIGQYYNIIRLGFDGYREVMENCLRNARLLSKA
LERTGWYVCVSDIHRKKGEYEFRGVGGVQPYHEGETSADYNEGLPVVAFRFSDQFKNDFP
DVKQESISLLLRAKQYIIPITERVMASEPIDLAALQGKPTSLARRQGKPEAKPLKKVTRA
KAGEGTHHPMAKGGHRSVC
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atggctagttttgttggcacctatatggaacgcgaagcccaggatttactcgttgagaac
atgagtaagaacctcgcggacgctgacgagtatcctgccctaatggatatccacgcgcgg
tgcatttcaatgattgcaaacatgtggcatccacagcctggtgagcatcccattggaacg
gccacaacaggatcatcagaggcaatccagcttggtggtttggctatgaagcgacgatgg
caagaaaagcgcaaagccgaaggaaaggatgcatcaaagcctaatataatcatgggagca
aatgcacaggtagcattattgaaatttgcgaggtatttcgatgttgaggcccggatactc
gacgtgtgtgaggagagtcactaccggcttgatccaaaggaggtcaagaaaaatgtggat
gagaacactattggcatatttgtcattttgggcagtacctataccggccattacgagcct
gtagaggagatctccaacatcctagatgaagtggaaaaggaacatggatgggatataccg
atccacgttgatggggccagtggtggctttatcgctccatttacgcacgctggggctggt
ggccctaaatgggatttcaacttgccgcgtgtgcactcaatcaacgtatcaggccataaa
ttcggcctcgtatatgtgggattaggatgggttatttggcgcgatcgccagtatctgcct
aaggacctcatttttcaactgcactacctggggggcacagaagaatcgttcgcattgaat
ttctctcgtcctgggctgcaggtaatcggccaatattacaatatcattcgccttggattt
gacgggtaccgggaagtgatggaaaactgtctccgaaacgcacggctcttgagtaaggcg
cttgaaagaacgggctggtatgtctgtgtcagcgacatccaccgcaagaaaggcgagtat
gaattccgtggcgtgggcggtgtccagccgtaccacgaaggggagacatcggcagattac
aacgaaggtttacctgtcgtcgcatttcggttttccgatcaattcaaaaacgacttcccg
gacgtcaaacaagagtcaattagtttgctgctgagagcaaagcaatatatcatccccatt
acggagcgggtgatggcttctgagccgatagatctggcagcgctgcagggcaagccgaca
tcactcgcacggcgccagggaaaaccagaggccaaacccctgaagaaagtcacaagagcc
aaagccggagaaggaacgcaccatcccatggcaaagggtggccatcgctcggtctgttga

DBGET integrated database retrieval system