KEGG   Verticillium alfalfae: VDBG_03337Help
Entry
VDBG_03337        CDS       T02227                                 

Definition
(RefSeq) linoleate diol synthase
Organism
val  Verticillium alfalfae
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
AA seq 1070 aa AA seqDB search
MKKDSNASHASSGSSTQPGRIDPAVNGNVRNAERKAKPIGDDVCGGHDEKSGKLAQFMKL
RKASKRPLPKDHGDGSYVIVPARPGVVQNLKVLRKRDIQTLATMIKGKLKGEKIKDDKTM
IMEYVIQMVAKLPHNSSLREKLTNTLIEELWDSLDHPPLLFVGDDWKYRRADGSHNNPLY
PWLGAAGQTYARSVAPKKPTLAALPDPGLIFDSIFARNEYTKHPNNVSSILWNWATIIIH
DLFWTDFRDINKSKTSSYLDLSPLYGSNQDMQDTIRTFKDGKLKADSFADKRLLGMPPTV
SVLLIMFNRFHNHVAENLAAINEGGRFTPPSPFLEGEAAEAASKKYDNDLFQTARLVTSG
LYINITLVDYVRNIVNLNRTNTTWTLDPRQESGMQVDTAEGAESGTGNMVSAEFNLCYRW
HSCISDKDDKWIQQFYGEILGGHQGELSPAEMGRIFMQYERSIPDDPIERTFGGYKRGEN
GKFSDDDLVDCVSASVEDPAGSFGARNVPKVMRPVEILGMLQARKWNVAGLNEFRKHFGL
KPYDRFEDINSDPKVSEALRNLYQKPDNVELYPGIVAEEAKSPMVPGVGIAPTYTISRVV
LSDAVCLVRGDRHYTTDYNPRYLTNWGFNEANYDLKINHGCVFYKLFIRAFPNHFKHNSV
YAHYPMVIPSENHKILTDLGRVDLFNFDRPAFTPLRVNVTSYGGAQHVLENKAAYRVTWH
EGLGAQMDEGGHKFMLAGDTDFHAGQKQCMASQLYKTDWHAAVRKFYADITEQLLQEKSY
TLGNTRRRHVDLVRDVGNITHVHFASRVFNLPLKTAANPKGVFSEQELYQLLAVIFVGIF
FDLDPVKSFPLRQAAREASQTLGKVIETNVKLATTLGIRGLFTGKADKNDPLAAYGTNLV
KGLKLSGLNNYDIAWSQILPTAGAMCPTKHKFFVGAARDAAHFPEPGGRGPRRPLGAYIH
YGLGPHACLGREASQVALTEMFRGLFRRRNVRREPGPQGELKKVPRPGGFFVYLREDWGG
VWPFPCSMKVMWDEDEVANGATNGTTNGATNGATNGQEGSAYESKDKATA
NT seq 3213 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaagactcaaacgcgtcgcacgcttcgagcggttcgtctacgcagcccggacgc
atagaccctgctgtcaatggcaatgtccgcaatgctgagaggaaggccaagccaattggt
gacgatgtctgtggcggtcacgacgagaagagtggcaagctcgctcagtttatgaagtta
aggaaagcttccaagcgaccgctacccaaagatcacggcgatggttcctatgttatcgtc
cctgcacgcccaggtgttgtccagaacctcaaggttcttcggaagcgagacattcaaaca
ctagcaacgatgatcaagggtaagctcaagggcgagaaaatcaaggatgacaaaaccatg
atcatggagtatgtcattcaaatggtcgcaaagttaccacacaactccagcctccgcgag
aagctcacgaacacgctcatcgaggagttgtgggactcacttgaccacccgccactgctg
ttcgtcggagatgactggaagtatcgccgagcagacggttcgcacaacaacccgctctac
ccctggctgggagctgccgggcagacatatgcgcgatctgttgcgcccaagaagccaacc
cttgcggccctgcctgaccctgggctaatttttgattccatctttgctcgtaatgagtat
acgaagcacccgaacaatgtgtcctcgattctctggaactgggcaaccatcatcattcac
gatcttttctggaccgatttccgtgacattaacaagtccaaaacctcgtcctatcttgat
ctctcgcccctctacggcagcaatcaagacatgcaggacacgatccgcaccttcaaggac
ggtaagctcaaagctgatagttttgccgacaagcgcctcctcggcatgccccctaccgtc
agcgtactcctcatcatgttcaaccgcttccataaccatgttgccgagaatttggcagct
atcaacgagggtggtcgattcacgccgccgtctcctttcctcgaaggcgaagcggcagag
gcggcgtcgaagaagtatgacaacgatctcttccagacggccagactcgtcacgtcagga
ctgtacattaacatcacgcttgtggactatgtccgcaatattgtcaacttgaaccgcact
aacactacttggacgctcgacccgaggcaggagtcaggcatgcaagttgacacggctgaa
ggagctgagtcgggaactggcaatatggtctcggccgagttcaacctctgctaccgatgg
cactcgtgcatctcagataaggatgacaagtggattcagcagttctatggcgagattctc
ggcggccaccagggggagttatcgcccgccgagatgggcaggatcttcatgcaatacgag
cgctccatcccggatgaccctattgagaggacttttggcggatacaagaggggcgagaac
ggcaagtttagtgacgacgatctcgtcgattgcgtcagcgcgtcggtcgaagatcctgcc
ggttcgttcggcgcacgtaatgtgcccaaggtcatgcggccagtcgaaattctaggcatg
ttacaagccagaaagtggaacgtcgccggcctcaacgagttccgcaagcacttcggtctc
aagccgtacgacaggtttgaagatatcaactcggaccccaaggtttctgaggcactgcgc
aacctgtatcagaaaccggataacgtcgagttgtaccccggtatcgttgccgaggaggcc
aagtcgcccatggtgccgggtgttggtatcgcccccacgtacaccatctcccgtgtcgtg
ctttcagacgccgtctgcctcgtccgcggtgatagacattacacgactgattacaacccg
cgttatctgaccaactggggtttcaatgaggccaactacgacctcaagataaatcacggc
tgcgtgttttacaagctgttcatccgcgcattcccgaaccacttcaagcacaactccgtc
tatgctcactatcctatggtcatcccctcagagaatcacaagattctgacggacctgggc
cgcgtcgacctgttcaactttgaccggcctgcattcacgccactgcgcgtcaacgttacc
tcctacggcggagcccagcacgtgctggagaacaaggctgcgtaccgcgtcacatggcac
gaaggtctgggagctcagatggatgagggcggccacaagttcatgctcgctggcgacacc
gacttccacgccggtcagaagcagtgcatggcgagccaactgtacaaaaccgactggcac
gccgccgtgcgtaagttctacgccgacatcacggagcagcttctccaagagaagtcctat
accctcggaaacacccgccggcgtcacgtcgacctcgtccgtgacgttggtaatatcacg
cacgtccacttcgcgtcgcgcgtcttcaacttgcccctcaagacggctgccaaccccaag
ggcgtcttctcggagcaggagctctaccagctgctggcggtcatctttgtcggcatcttc
ttcgatttggaccccgtcaagtcgttcccgctgcggcaggctgcgcgcgaggcgtcgcag
acgctcggaaaggtgattgagacgaacgtcaagttggcaacgacgctcggcattcgcggc
ctcttcacaggcaaggcggacaagaacgacccgcttgccgcgtacggcacgaacctcgtc
aagggactcaaattatctggtctcaacaactacgatattgcgtggagccagatcctccct
acagcgggcgccatgtgcccaaccaagcacaagttctttgttggcgcggcgcgcgacgct
gcccactttcccgaacccggaggtcgcggaccccgccgtccgctgggggcgtacattcac
tacggcctcgggccacacgcgtgcctcgggcgcgaggcgagccaggtcgcgctcacggag
atgttcaggggtctcttccgcagacggaacgtcaggagggagccgggcccgcagggtgag
ctcaagaaggtgccgagacccggtgggttcttcgtctacctgagggaggactggggtggc
gtgtggccgttcccgtgctccatgaaggtcatgtgggacgaggacgaggtcgccaacggg
gccacgaacgggaccacgaacggggctacgaacggggccacgaatggtcaagaagggtcc
gcctacgagtcgaaggacaaggcgacggcgtag

DBGET integrated database retrieval system