KEGG   Variovorax paradoxus S110: Vapar_1660Help
Entry
Vapar_1660        CDS       T00916                                 

Definition
(GenBank) DNA ligase D
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
vap  Variovorax paradoxus S110
Pathway
vap03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:vap00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    Vapar_1660
Enzymes [BR:vap01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Vapar_1660
DNA repair and recombination proteins [BR:vap03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     Vapar_1660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: ACS18310
JGI: Vapar_1660
UniProt: C5CTW0
LinkDB All DBs
Position
1:1793621..1796164
Genome map
AA seq 847 aa AA seqDB search
MARANPLKRYKEKRNFGATPEPAEGGASAPGVLQFVVQKHWATRLHYDFRIELDGAMKSW
AVPKGPSYDTHDKRMAVHVEDHPIAYNQFEGEIPPRQYGAGKVIIWDKGSWTPIGDPRKG
YRAGRLKFELHGYKLRGKWTLVRMHGKADDKQDAWLLIKEHDEYARPAAEFSVVDQFPDS
VAQMPMPAAAVSAPAEAPAAPARKRGGKASASGMPADAVKAAMPAKLSPLLATLVDGPPH
DPQNWLYEIKFDGYRLLARIDAKGGVQLVTRNGHDWSSRMPHLVRAIERMKLAPGWLDGE
IVVLNESGGTDFQALQNAFDSENTRNIVYFLFDLPYYGGFDLTGVPLVERRGLLQALLAK
APPEIRFSEIFDAPPEDIVASACKIGLEGVIGKRKNSTYASRRSPDWIKLKCSQRQEFVI
GGYTDPKGSRVGIGALLIGVHDDKGDLIYAGAVGAGFNGRTLADMLERLKPLGIDKRPFK
NPTENDRRAHWVKPVLLAEVTFSEWTKDGHVRHPVFHSVRSDKPAKAIVREKPVHPAGAG
REAEAEPEPAATMPANFKVSHADRVVDPSTGITKVEVVRFYGLVAPLMMPHLKGRPVSFV
RAPQGIGGQLFFQKHLELGQMAGVRQLDAALWPKHPELIEIAGPLGLLSAAQMNVVEFHT
WNGLKTLIGKPDRMTFDLDPGEGVGWPMVLQAAELMRVVLDELGLAPFCKTSGGKGLHVV
VPLKRQYDWDTIKDFSQAIVRHMARTLPQMFVAKSGPDNRVGRIFIDYLRNGFGATTICA
WSVRARPGMGVSVPVEWQEVPTLTSGAQWTLRNIHARLDRGNDPWAAYAKAAKSPGAAMK
LLGFRVR
NT seq 2544 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgcgcaaaccccctgaagcgctacaaggaaaagcgcaacttcggcgccaccccc
gagcccgcggagggcggcgcatcggcgcccggcgtgctgcagttcgtggtgcagaagcac
tgggcgacccggctgcactacgacttccgcatcgagctcgatggcgccatgaagagctgg
gccgtgcccaagggcccgagctacgacacgcacgacaagcgcatggccgtgcatgtggag
gaccatcccatcgcctacaaccagttcgagggcgagataccgccccggcaatacggcgcg
ggcaaggtgatcatctgggacaagggcagctggacgcccatcggcgatccgcgcaagggc
tacagggcggggcgcctcaaattcgagctgcacggctacaagctgcgcggcaagtggacg
ctggtgcgcatgcacggcaaggccgacgacaagcaggacgcgtggctcttgatcaaggag
cacgacgagtacgcccgcccggccgcggagttcagcgtggtcgaccagttcccggacagc
gtggcgcagatgccgatgcccgctgcggcggtctcggcgcccgccgaggcgccggccgca
ccggccagaaagcgcggcggcaaggcatcggccagcggcatgcccgccgatgcggtgaag
gccgccatgccggccaagctctcgccgctgctcgccacgctggtcgacggcccgccgcac
gatccccagaactggctgtacgagatcaagttcgacggctaccgcctgctcgcgcgcatc
gatgcgaagggcggcgtgcagctcgtcacgcgcaacggccatgactggagcagccgcatg
ccgcacctggtgcgcgcgatcgagcgcatgaagctcgcgcccggctggctcgatggcgag
atcgtggtgctcaacgagtccggcggcacggacttccaggccctgcagaacgccttcgac
agcgagaacacgcgcaacatcgtctacttcctgttcgacctgccgtactacggcggcttc
gatctcaccggcgtgccgctggtcgagcggcgcggcctgctgcaggcgctgctggccaag
gcgccgcccgaaatccgcttcagcgagatcttcgatgcgccgcccgaggacatcgtggct
tcggcctgcaagatcgggctcgaaggcgtgatcggaaagcgcaagaacagcacgtacgcc
tcgcgccgctcgcccgactggatcaagctcaagtgctcgcagcggcaggagttcgtcatc
ggcggctataccgatccgaagggctcgcgcgtgggcattggcgcactgctgatcggcgtg
cacgacgacaagggcgacctcatctacgccggcgcggtgggcgcgggcttcaacggccgg
acgctcgccgacatgctcgaaagattgaagccgctcggcatcgacaagcggccgttcaag
aacccgaccgagaacgaccgacgcgcgcactgggtcaagccggtgctgctggccgaggtc
acgttttccgaatggacgaaggacggccatgtgcggcatccggtgttccacagcgtgcgc
tcggacaagcccgcgaaggccatcgtccgcgagaagccggtgcacccggcgggcgccggc
cgcgaagcggaggctgagcccgaacccgccgccaccatgcccgccaacttcaaggtctcg
catgccgaccgcgtggtcgatccgtcgaccggcatcaccaaggtggaggtggtgcgcttc
tacggcctggtcgcgccgctgatgatgccgcacctgaagggccggcccgtgtcgttcgtg
cgcgcgccgcagggcatcggcggccagctgttcttccagaagcacctggagctggggcag
atggccggcgtgcggcagctcgatgcggcgctgtggcccaagcaccccgagctgatcgag
atcgcggggccgctcgggctgctgagtgcggcgcagatgaacgtcgtcgagttccatacc
tggaacggcctgaagacgctcatcggcaagcccgaccgcatgaccttcgacctcgacccg
ggtgagggcgtcggctggcccatggtgctgcaggccgccgagctgatgcgcgtggtgctc
gacgaactgggcctggcgccgttctgcaagaccagcggcggcaaggggctgcacgtggtg
gtgccgctcaagcggcagtacgactgggacaccatcaaggatttctcgcaggccatcgtg
cggcacatggcgcgcaccctgccgcagatgttcgtcgccaagagcgggccggacaaccgc
gtcggccgcatcttcatcgactacctgcgcaacggcttcggcgcgaccaccatctgcgcc
tggtcggtgcgggcgcgccccggcatgggggtgtcggtgccggtggaatggcaggaggtt
cccacgctcacgagcggtgcgcagtggaccctgcggaacatccatgcacggctcgaccgc
ggcaacgatccgtgggctgcgtatgcaaaggctgcaaagagtccgggagccgcaatgaag
ctgctgggcttcagagttcgatga

DBGET integrated database retrieval system