KEGG   Variovorax paradoxus S110: Vapar_3031Help
Entry
Vapar_3031        CDS       T00916                                 

Definition
(GenBank) Ribulose-bisphosphate carboxylase
  KO
K01602  
ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
vap  Variovorax paradoxus S110
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:vap00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Vapar_3031
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Vapar_3031
Enzymes [BR:vap01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Vapar_3031
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
1:complement(3189240..3189659)
Genome map
AA seq 139 aa AA seqDB search
MRITQGTFSFLPDLSDEQISRQVEYCLGKGWAIGLEYTDDPHPRNTFWEMFGNPMFDIKD
AAGVMLELAACRKTFPQQYIRVTAFDSTHGTESVVMSFIVNRPSNEPGFRLIRTEEPGRT
IRYSLESYAVQARPEGSRY
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgcgaatcacacaaggcaccttttccttcctgcccgacctgagcgacgagcagatcagc
cgccaggtcgagtattgcctgggcaagggctgggccatcggcctcgaatacaccgacgac
ccgcatccgcgcaacaccttctgggagatgttcggcaacccgatgttcgacatcaaggat
gcggccggcgtgatgctcgaactcgcggcctgccgcaagacctttccgcagcaatacatc
cgcgtgacggccttcgattcgacgcacggcaccgagtcggtcgtgatgtccttcattgtc
aaccggccgtcgaacgaaccgggcttccgcctgatccgcaccgaggagccgggccgcacg
atccgctacagcctcgaaagctatgcggtgcaggcgcggcccgaaggcagccgctactga

DBGET integrated database retrieval system