KEGG   Vigna angularis (adzuki bean): 108340660Help
Entry
108340660         CDS       T04660                                 

Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
var  Vigna angularis (adzuki bean)
Pathway
var03030  DNA replication
var03410  Base excision repair
var03420  Nucleotide excision repair
var03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:var00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    108340660
   03410 Base excision repair
    108340660
   03420 Nucleotide excision repair
    108340660
   03430 Mismatch repair
    108340660
Enzymes [BR:var01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     108340660
    6.5.1.6  DNA ligase (ATP or NAD+)
     108340660
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     108340660
DNA replication proteins [BR:var03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    108340660
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     108340660
DNA repair and recombination proteins [BR:var03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     108340660
   NER (nucleotide excision repair)
    Other NER factors
     108340660
   MMR (mismatch exicision repair)
    Other MMR factors
     108340660
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-GeneID: 108340660
NCBI-ProteinID: XP_017433665
LinkDB All DBs
Position
8
AA seq 786 aa AA seqDB search
MLALHFRSSFGSSFRLSFCFSRTVRVPSLVSFPLSLFSVPLRVMSKPPSAFDALMAAAKK
NSKSKTSKLSSPPKKRKSPLSTSSQNPSNPKSPKLPSPPITVEPEQAVKQEEVAKPEAVK
PEPRKVRQLSTSSSKGKTEELKKQVAQLKQKPSSFDPASMIAWEKGEPVPFLFLALAFDM
ISQESGRIVITDIVCNVLRTVMLATPEDLVPVVYLSANRIAPAHEGLELGIGESIISKAL
AEAYGRNENWIKTQYQKKGDLGLVAKESRSSQPMMWKPEALTIRKVFNTFRLIAKESGKD
SQEKKKNHIKALLVAATDCEPQYLIRLLQTKLRIGYAEQTLLAALGQAAVYTEEHSKPPP
EIQSPFEKASDIVKQVYSVLPDYDKIISALLTEGLWKLPKTCKFTPGVPIRPMLSKAAKS
VTEVLNKFQDVEFTCEYKYDGERAQIHYLENGSVEIYSRQAERNTEKFPDVAAAVSRLKK
TSVSSFILDCEIVAYDRATQKLLSFQTLSTRARKKVEIEDIKVNVCVFAFDLLYLNGQEL
LQENLRVRREHLYASFEEESGFLQFATALTSNDVEEIQNFLDQAVGASCEGLIIKTLNED
ATYEPAKRSLNWLKLKKDYMDNLGDSVDLVPIAAFHGRGKRTGVYGAFLLACYDNNNEEF
QTICKIGTGFSESVLVERSSSLRSQVISKPKSYYRFGETINPDVWFEASEVWEVRAADLT
ISPVHRAAAGIVDPNKGISLRFPRLVRVRHDKAPEQATSSEQIAELYKAQKHNQANKQDD
EDEEDY
NT seq 2361 nt NT seq  +upstreamnt  +downstreamnt
atgctcgcattgcattttcgatcatcttttggttcttcttttcgtctttctttctgtttc
tctcgaactgttagggttccttctctcgtctctttccctctttctctcttctctgtccct
ctccgcgtcatgtctaagccaccatccgccttcgacgctctcatggccgccgctaagaag
aattccaaatccaaaacatccaagctttcatcacctcccaagaaaagaaaatctccactc
tccacttcctcacaaaaccctagcaaccccaaatctcccaaactgccttctccgcccata
accgttgaaccggagcaagcagttaaacaggaagaagttgctaaaccagaagctgttaag
ccggaaccgcggaaggtacgccaactgtcaacgtcttcttcgaaggggaagacggaggag
ctgaagaagcaagttgcgcagctgaagcagaagccttccagtttcgatcccgcttcgatg
attgcatgggagaagggagagcccgtgccgtttctctttctcgccttggcattcgatatg
atttctcaggaaagtggaagaatagttatcactgacattgtttgcaatgtgctgcggact
gtgatgctggccacgccggaggatcttgttcccgtcgtttacctctccgcaaaccggatt
gcgcctgctcatgaagggttggaattgggaatcggcgagtcgatcatttccaaggcgctc
gcggaggcttatggaaggaacgagaattggattaagactcagtatcagaaaaaaggtgat
ttgggcttggttgccaaagagagccgttcatctcaacctatgatgtggaagcctgaagca
ttaaccatcaggaaggttttcaacacttttcgccttattgctaaggaatctggaaaagac
agtcaagagaaaaaaaagaatcatatcaaggcacttcttgttgctgcaactgactgtgaa
cctcaatatctaattcgtttgcttcagacgaagttgcgaattggttatgcagagcaaact
ctattggctgcactaggccaagctgcggtatacactgaagaacactctaaaccgcctcct
gaaattcagtctccttttgaaaaggcttcggatattgttaaacaagtctattctgttctt
cctgactatgacaaaataatatctgcactgcttacggagggtctatggaagcttccaaag
acttgtaaatttactccaggtgttccaattagacctatgctatcaaaggcagcaaaaagt
gtaactgaagttctgaacaaattccaggatgtggaatttacctgtgaatacaaatacgat
ggagagcgtgcccagatacattacttggagaatggttcagttgagatttacagtagacaa
gcagaacggaacaccgagaagtttcctgatgttgctgctgcagtttcaaggttgaagaaa
acaagtgtatcttcatttattcttgattgtgaaattgttgcatatgaccgtgcaacacaa
aaacttctttctttccagaccctcagtactcgagctcgcaagaaagtagaaattgaagat
ataaaggttaatgtttgtgtatttgcttttgatttgttgtatctaaatggccaagaactt
cttcaggaaaaccttagagtccgcagagagcatctttatgcctcttttgaggaagaatct
ggttttctccagtttgcaacagcattaacttcaaatgatgttgaggagatacagaatttt
cttgaccaagctgttggtgctagttgtgagggattgattattaagacactaaatgaggac
gctacatatgaacctgccaagcgatcactcaactggctaaaactgaagaaagattatatg
gacaatttaggggactctgtagacttggtacctattgctgctttccatgggcgtggaaaa
cgtacaggagtttatggtgccttcctccttgcttgctatgacaacaataatgaagaattt
caaactatttgcaagattggaacgggtttctctgaatctgtacttgtagaacgttcttcc
agtcttcgctctcaagtgatttccaagccgaagtcatactatagatttggggaaacaatc
aatcctgatgtctggtttgaagccagtgaggtgtgggaggtgagagcggcagacctgacc
attagccctgtccaccgtgctgcagcgggcatagtagatccgaacaagggcatctctctt
cgatttccaaggctggttcgagtccggcatgacaaagctcctgaacaggccacatcatct
gagcagattgctgagttgtataaagctcaaaaacacaatcaagcgaataaacaagatgac
gaagatgaagaagattattga

DBGET integrated database retrieval system