KEGG   Vibrio cholerae O1 biovar El Tor FJ147: IR04_13130Help
Entry
IR04_13130        CDS       T03827                                 

Definition
(GenBank) superoxide dismutase
  KO
K04565  
superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
vcf  Vibrio cholerae O1 biovar El Tor FJ147
Brite
Enzymes [BR:vcf01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     IR04_13130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
I:complement(1778607..1779122)
Genome map
AA seq 171 aa AA seqDB search
MNQFTLFAVVAFFSSSVLAQEMTVVMTDLSSGQSVGTVTVTDSEYGTVFTPQLTGLPAGL
HGFHVHANGSCETSSKDGKTVLGGAAGGHYDPQNTGKHGYPWTNDNHLGDLPALYVDAQG
QANQPVLASRFKMAEVKGKALMVHAGGDNHSDHPMPLGGGGARIVCGVIGL
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaatttactttgtttgctgtcgtcgctttcttctcttcttcggttttggctcaa
gaaatgactgtggtgatgacggatttgagctctggccaatccgtgggcaccgtgaccgta
actgatagcgagtatggtacggtctttactccgcagttaactggcttgccagccggtttg
cacggttttcatgtacacgcgaatggctcatgtgaaacctcgtccaaagatggcaaaacc
gtattaggtggcgctgcgggtgggcattatgatccgcaaaacacgggaaaacacggctat
ccgtggaccaacgacaatcacttgggtgatctcccagctttgtacgtggatgcgcaaggc
caagcaaatcaacccgttttggcatcccgcttcaaaatggcagaggtaaaaggtaaagct
ttgatggtccacgcgggcggggataaccattccgaccatccaatgcctttgggtggcggt
ggtgcgcgcatcgtatgtggtgtgattggtttataa

DBGET integrated database retrieval system