KEGG   Vibrio cholerae MJ-1236: VCD_002794Help
Entry
VCD_002794        CDS       T00903                                 

Definition
(GenBank) superoxide dismutase [Cu-Zn] precursor
  KO
K04565  
superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
vcj  Vibrio cholerae MJ-1236
Brite
Enzymes [BR:vcj01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     VCD_002794
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
1:1969362..1969877
Genome map
AA seq 171 aa AA seqDB search
MNQFTLFAVVAFFSSSVLAQEMTVVMTDLSSGQSVGTVTVTDSEYGTVFTPQLTGLPAGL
HGFHVHANGSCETSSKDGKTVLGGAAGGHYDPQNTGKHGYPWTNDNHLGDLPALYVDAQG
QANQPVLASRFKMAEVKGKALMVHAGGDNHSDHPMPLGGGGARIVCGVIGL
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaatttactttgtttgctgtcgtcgctttcttctcttcttcggttttggctcaa
gaaatgactgtggtgatgacggatttgagctctggccaatccgtgggcaccgtgaccgta
actgatagcgagtatggtacggtctttactccgcagttaactggcttgccagccggtttg
cacggttttcatgtacacgcgaatggctcatgtgaaacctcgtccaaagatggcaaaacc
gtattaggtggcgctgcgggtgggcattatgatccgcaaaacacgggaaaacacggctat
ccgtggaccaacgacaatcacttgggtgatctcccagctttgtacgtggatgcgcaaggc
caagcaaatcaacccgttttggcatcccgcttcaaaatggcagaggtaaaaggtaaagct
ttgatggtccacgcgggcggggataaccattccgaccatccaatgcctttgggtggcggt
ggtgcgcgcatcgtatgtggtgtgattggtttataa

DBGET integrated database retrieval system