KEGG   Vibrio cholerae M66-2: VCM66_0305Help
Entry
VCM66_0305        CDS       T00891                                 

Gene name
tufB
Definition
(GenBank) elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
vcm  Vibrio cholerae M66-2
Brite
Translation factors [BR:vcm03012]
 Eukaryotic Type
  Elongation factors
   VCM66_0305 (tufB)
 Prokaryotic Type
   VCM66_0305 (tufB)
Mitochondrial biogenesis [BR:vcm03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    VCM66_0305 (tufB)
Exosome [BR:vcm04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   VCM66_0305 (tufB)
  Exosomal proteins of breast cancer cells
   VCM66_0305 (tufB)
  Exosomal proteins of colorectal cancer cells
   VCM66_0305 (tufB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
I:320052..321236
Genome map
AA seq 394 aa AA seqDB search
MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAICTVLAKVYGGKARDFASIDNAPEERERG
ITINTSHVEYDTPNRHYAHVDCPGHADYVKNMITGAAQMDGGILVVAATDGPMPQTREHI
LLGRQVGIPYIIVFMNKCDMVDDEELLELVEMEVRELLSEYDFPGDDLPVIQGSALGALN
GEAQWEAKIVELAEALDTYIPEPERAVDMAFLMPIEDVFSIQGRGTVVTGRIERGILKVG
DEVAIVGIKETVKTTCTGVEMFRKLLDEGRAGENVGALLRGTKREEVERGQVLAKPGSIT
PHTKFESEVYVLSKDEGGRHTPFFKGYRPQFYFRTTDVTGSIELPEGVEMVMPGDNVKMV
VDLIAPIAMDEGLRFAIREGGRTVGAGVVAKIIA
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaagagaaatttgaacgtacgaaaccgcacgtaaacgttggtactatcggccac
gttgaccacggtaaaacaactctaactgcagctatctgtactgtacttgcaaaagtatac
ggcggtaaagctcgtgacttcgcgtcaatcgacaacgcaccagaagagcgtgagcgtggt
attacaatcaatacttctcacgtagagtacgatactccaaaccgtcactacgcacacgta
gactgtccaggacacgcggattatgttaagaacatgatcaccggtgcagcacagatggac
ggcggtatcctagttgtagcggcaactgacggtccaatgccacaaactcgtgagcacatc
ctgctgggtcgccaagtaggtattccttacatcatcgtattcatgaacaagtgtgacatg
gttgacgatgaagagcttctagagctggtagagatggaagttcgtgagctgctgtctgag
tacgatttcccaggtgatgacctgccagtaatccaaggttcagcactaggcgcgctaaac
ggcgaagcacagtgggaagcgaagattgttgagctagcagaagcactggatacttatatt
ccagagccagagcgtgcagtagacatggcattcctgatgccaatcgaagacgtattctca
atccaaggtcgtggtacagtagtaactggccgtatcgagcgcggcatcctgaaagtgggt
gacgaagtagcgatcgttggtatcaaagagacagtaaaaacgacctgtacaggtgtagag
atgttccgtaagctgcttgacgaaggtcgtgcaggtgagaacgtaggtgcactactacgt
ggtactaagcgtgaagaagtagagcgtggtcaagtactggcgaagccaggttcaatcaca
ccacacactaagttcgaatcagaagtatacgtactgtcaaaagatgaaggtggccgtcat
actccattcttcaaaggttaccgtccacagttctacttccgtacaactgacgtaacaggc
agcatcgagctaccagagggcgtagaaatggtaatgccaggcgacaacgtgaagatggtt
gtagacctgattgcaccaatcgcgatggacgaaggtctacgcttcgctatccgtgaaggt
ggccgtactgtaggtgctggtgttgtagctaagatcatcgcttaa

DBGET integrated database retrieval system