KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_96572Help
Entry
VOLCADRAFT_96572  CDS       T01330                                 

Definition
(RefSeq) ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
vcn  Volvox carteri f. nagariensis
Pathway
vcn00630  Glyoxylate and dicarboxylate metabolism
vcn00710  Carbon fixation in photosynthetic organisms
vcn01100  Metabolic pathways
vcn01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:vcn00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    VOLCADRAFT_96572
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    VOLCADRAFT_96572
Enzymes [BR:vcn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     VOLCADRAFT_96572
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-GeneID: 9626476
NCBI-ProteinID: XP_002955677
JGI: 96572
UniProt: A0A125YYX7
LinkDB All DBs
Position
Unknown
AA seq 185 aa AA seqDB search
MAAIVAKSSVAAVVARPARSSVRPVAGLKPAVKAAPVAAPAQANKMMVWTPVNNKMFETF
SYLPPLTDEQIAAQVDYIVANGWIPCLEFAEADKAYVSNESTVRFGPVSCLYYDNRYWTM
WKLPMFGCRDPMQVLREIVACTKAFPDAYVRLVAFDNVKQVQIMGFLVQRPKSARDWQPA
NKRSV
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atggccgctattgttgctaagtcgtctgtggccgccgttgttgcgcgccccgcccgcagc
agcgtgcgcccagttgccggtctgaagccggctgttaaggctgccccggttgctgctcca
gcccaggctaacaagatgatggtctggaccccggtgaacaacaagatgttcgagaccttc
tcctaccttccgcctctgacagacgagcagattgctgcccaggttgactacatcgtcgcc
aacggctggattccttgccttgagttcgctgaggctgacaaggcctacgtctcgaacgag
tcgaccgtccgcttcggcccagtctcctgcctgtactacgacaaccgctactggacgatg
tggaagctgcccatgttcggctgccgcgacccgatgcaggtgctgcgcgagattgttgcc
tgcaccaaggccttcccggacgcctacgtgcgcctggtggccttcgacaacgtgaagcag
gtgcagatcatgggcttcctggtgcagcgccccaagagcgcccgcgactggcagccggcc
aacaagcgctccgtctaa

DBGET integrated database retrieval system