KEGG   Vibrio cholerae O395: VC0395_0515Help
Entry
VC0395_0515       CDS       T00520                                 

Gene name
ddlA
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  
D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
vco  Vibrio cholerae O395
Pathway
D-Alanine metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:vco00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    VC0395_0515 (ddlA)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    VC0395_0515 (ddlA)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    VC0395_0515 (ddlA)
Enzymes [BR:vco01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     VC0395_0515 (ddlA)
Peptidoglycan biosynthesis and degradation proteins [BR:vco01011]
 Precursor biosynthesis
  Amino acid ligase
   VC0395_0515 (ddlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1:complement(568820..569809)
Genome map
AA seq 329 aa AA seqDB search
MTKTTILLLCGGGSSEHEISLVSANYIQQQLELTPEFHVIRVEMKKEGWFSEQGALVYLD
TNSATLNSDKASYPIDFVVPCIHGFPGETGDIQSMLELAGIPYLGCGPEASANSFNKITS
KLWYDALDIPNTPYLFLTQNTPSSIDKAKQAFGHWGSIFVKAARQGSSVGCYKVTTEDQI
APAIEAAFGFSEQVLVEQAVKPRELEVSAYEMNGKLYISKPGEVIAPEGTFYSYEEKYSA
NSHARTVLEAENLTEKHKELIQTYAERVFIHMKLRHLSRIDFFLTQEGQIYLNEVNTFPG
MTPISMFPKMLEHNGHRFSEFLAQCVTNT
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgactaagacaacaatcctacttttgtgcggtggcggctcatctgagcacgaaatttct
ctcgtatcagccaactacatccaacaacagcttgaactgactccagagtttcacgtgatt
cgagtcgagatgaaaaaagagggatggttttccgaacaaggagcccttgtatacctcgat
acaaatagcgcaacattaaatagcgataaggcttcctacccaatagattttgttgttcct
tgcatccatggtttcccgggagaaactggggatattcaatccatgttagaactggcaggc
attccttatctaggctgtgggccagaagccagtgcaaacagctttaacaaaatcacgtcc
aaactatggtatgacgcattagatattcctaacacaccgtatctatttttaacccaaaat
acaccaagctcgattgataaagccaagcaagcttttggtcattggggaagtatctttgtc
aaagctgctcgtcagggttcttcagtcggatgctacaaagtaaccacagaagatcagatt
gcccccgccattgaggctgcttttggtttctcagagcaagttcttgtcgagcaagccgtt
aaacctagagagttagaggtttctgcttatgagatgaacggaaaactctatatctcaaaa
ccgggagaagtgattgcaccagaaggtacattctattcatatgaagaaaagtacagtgcg
aatagccacgccagaaccgtcttagaagctgaaaatctaaccgagaaacacaaagaatta
attcaaacatatgctgaacgtgtattcatccatatgaagcttcgtcatttatctcggatc
gactttttcttgactcaagagggacaaatttacctcaatgaggtcaatacatttccagga
atgacaccgatttccatgtttccgaaaatgctagagcataacggacaccgatttagtgaa
ttcctcgcgcaatgtgtcaccaacacatag

DBGET integrated database retrieval system