KEGG   Vibrio coralliilyticus RE98: IX92_15015Help
Entry
IX92_15015        CDS       T03444                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
vcy  Vibrio coralliilyticus RE98
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:vcy00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    IX92_15015
  Energy metabolism
   00680 Methane metabolism
    IX92_15015
Enzymes [BR:vcy01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     IX92_15015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1:3215634..3218267
Genome map
AA seq 877 aa AA seqDB search
MNEKYSALRSNVSMLGHLLGNTIKDAHGDALLEKVETIRKLSKSALSGNQSDRESLIEEI
KSLPDEQLTPVAHAFNQFLNLTNMAEQYHTISRHCDTHVCEPDAINNLFSKLSQNDISKL
DTAQAVRDLNIELVLTAHPTEITRRTMINKLVKINKCLSKLELNDLSAKERQKTERRLEQ
LIAQGWHSDTIRQQRPTPLDEAKWGFAVVENSLWEAVPDFLRELDGRLRGYLEEGLPIDA
RPVHFSSWMGGDRDGNPFVTHTITREVMLLSRWKAADLYLNDINELVSELSMTRCNDAVR
SLAGEDEHEPYRAVLKQLRALLTETKEILDAKVNGQKLAVKAPLQRVEQLWEPLYACYQS
LHECGMGIIADGSLLDTLRRIKAFGVHLVRLDIRQESTRHSDALSELTRYLGIGDYNQWS
EQDKIAFLTNELASKRPLLPRDWQPSEQVQEVLDTCKIVAAQPREAFGAYVISMARTASD
VLAVHLLLQEAGCPYRMDVCPLFETLDDLNNAESVIKQLMGIDLYRGFIQNHQMVMIGYS
DSAKDAGVMSAGWAQYHAMEALVKVAEEEGVELTLFHGRGGTIGRGGAPAHAALLSQPPK
SLKGGLRVTEQGEMIRFKLGLPEVAVNSFNLYASAILEANLLPPPEPKQEWRDLMNVLSE
VSCEAYRSVVRGEPDFVPYFRQATPELELGKLPLGSRPAKRNPKGGVESLRAIPWIFSWS
QNRLVLPAWLGAGEAIQYSIDKGHQALLEEMCREWPFFSTRLGMLEMVYTKCNLEISRYY
DERLADPKLLPLGDKLRAQLQQDIKAVLNVENNENLMQSDPWGQESIRLRNIYVEPLNML
QAELLYRTRQNDAASPELEEALMVTIAGIAAGMRNTG
NT seq 2634 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagaaatactctgcactcagaagcaacgtgagcatgttagggcacttgctcggt
aacaccattaaagacgcccatggtgatgcccttctggaaaaagtagaaacgattcgtaag
ctttctaagtctgcactttctggcaatcaatcagatcgtgaaagcttgattgaggaaatc
aaaagcctacccgatgagcaactaacgcctgttgcccatgctttcaaccaattcctcaac
ctgacgaacatggcggagcagtaccacactatttcacgtcattgcgatacacatgtctgc
gaaccagacgccatcaacaacctgttttctaaacttagccaaaacgacataagcaaactc
gacactgctcaagcggtgcgagatctcaacattgagttagtgcttactgcgcacccaacc
gaaatcactcgacgcaccatgatcaacaagctggtcaaaatcaataagtgtttgtcgaaa
ctagagttaaacgacctgtcagccaaagaacgtcagaagactgaacgtcgcctcgaacaa
ttgattgcccaaggctggcactctgacaccattcgtcagcagcgcccaactcctcttgat
gaagccaaatggggctttgctgtcgtcgagaactccttatgggaagcggtgcctgacttc
ttacgcgaattggacggtcgtctgcgtggttatcttgaagaaggcctgccgattgatgct
cgccctgtgcatttctcttcttggatgggtggcgaccgtgatggtaacccatttgtcacc
cacactattacccgagaagtcatgctgctgtcacgctggaaagccgcagatctgtacctc
aatgacatcaatgagctggtcagtgaactgtcgatgacccgctgcaatgacgcggtacgc
tcgctcgcgggagaagacgaacacgaaccttaccgcgccgtactgaaacagctgcgagct
ttgctgactgaaaccaaagaaatactggatgccaaagtaaatggtcagaagctggctgtc
aaagctccccttcaacgtgtcgagcagttatgggaacctctttatgcttgttaccaatct
cttcatgagtgcggtatgggcatcattgctgatggctcgcttctcgacacgctacgccga
atcaaagcctttggggttcatctcgtacgcctcgatattcgtcaggaaagtacgcgccac
tccgatgctttatcagagctgactcgctaccttggcattggtgattacaaccagtggagc
gaacaggacaagatagcgttcttgaccaatgagctggcctccaaacgcccacttctccca
cgtgactggcaaccatccgagcaagtccaagaagtgctcgatacctgcaagattgtggcc
gcccaaccacgtgaagcctttggagcttacgtgatttctatggcgcgcacggcttctgac
gtattggccgtacacctgttattacaagaagcaggctgtccgtatcgcatggatgtgtgc
ccactgtttgaaacgttagacgatctgaataatgccgaatccgtcatcaaacaattgatg
ggcattgatctctaccgtggctttatccagaaccatcaaatggtgatgatcggttactct
gattcagcaaaagatgctggtgtgatgtcagcgggctgggctcagtatcatgcgatggaa
gcactggtcaaagtcgctgaagaagaaggggttgagctgacactgttccacggtcgaggt
ggtaccattggtcgaggtggtgcgcccgctcatgcagctcttttatctcaaccaccgaag
agcttgaaaggtggcctgcgagtgacagaacaaggggaaatgatccgcttcaagctgggc
ttacctgaagttgctgttaacagcttcaatctatatgccagtgcgatcttggaagctaac
ctgctgccgcctcctgaaccaaaacaagagtggcgcgatctgatgaatgtactttcagag
gtcagttgtgaggcgtatcgaagtgttgttcgcggtgaacctgactttgttccgtacttc
cgtcaagcaacgccagaattggagttaggtaaactacctcttggctctcgccccgctaaa
cgtaatccaaaaggtggcgtagaaagcttacgtgcaattccatggatcttctcttggagc
caaaaccgtttggttctaccggcgtggttaggtgctggtgaagccattcaatactccatc
gataaaggtcatcaggcgctactcgaagagatgtgtcgtgagtggccgttcttctccact
cgcttaggcatgctggaaatggtgtacaccaagtgtaaccttgagatctcacgttactat
gatgagcgcttagctgatcctaaactgctgcctctgggcgataagctgcgagctcaactt
cagcaagatatcaaagctgtgctcaacgtagaaaacaacgagaacctgatgcaaagcgat
ccatggggtcaagagtctattcgcctacgtaacatttacgtcgagccattgaacatgctg
caggctgaactgctttatcgtactcgtcagaacgacgctgcatcaccagagctggaagaa
gcattgatggtaactatcgctggtattgctgcgggcatgcgcaacacaggataa

DBGET integrated database retrieval system