KEGG   Vulcanisaeta distributa: Vdis_0679Help
Entry
Vdis_0679         CDS       T01313                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
vdi  Vulcanisaeta distributa
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:vdi00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Vdis_0679
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Vdis_0679
   00680 Methane metabolism
    Vdis_0679
Enzymes [BR:vdi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Vdis_0679
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
complement(658232..659767)
Genome map
AA seq 511 aa AA seqDB search
MNLIPRSMCTQHPDNARVPDWARDSIIQGDDEVHEAYLAYSLYGCHEVMWDFEGKDVDIY
VVRKLLSRYPGFFRDHVLGRDVYLTLRLPNPWAETAEKKLFSQALELIPTAYDVAREFYG
TDDINGVFQVILPLTSRAEELVFTYRYYERVVAGKAFIELTPGVRVMDVLGSVRPSTIDV
IPLIEDLGSMLNVGKIIIGYWRVVRPSYLRIFIARSDPAMNYGLIPAVLMAKIALNKALN
LGRELGLEIYPIIGVGPTPFRGNLTPHNVDNVVREYPCVHTFTVQSAFRYDYPEGEVINA
ISKLNNRKPDGGCDIPNHGVLINVINKYVVNYQREIEGLANVINRVSNYVPRRRARKLHI
GLFGYSRGFRGVVLPRAITFVAALYSLGIPPEVLGVSTINELSDREYSALSEAYVNLRHD
LSMAARYVCHECLDMLTKLGNSFGITREVIDMVKRDIKTLEEMGIKTGPSDYDSRKHELL
TQLFINSLVEGKEDDAVKYMVEMALIRHAIG
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgaacctcattccaaggagcatgtgcacgcagcacccggacaacgccagagtacctgac
tgggctagggatagtattatccagggggatgacgaggttcacgaggcttacctagcatac
agtctatatggttgtcatgaggtcatgtgggacttcgagggtaaggacgtggatatctac
gtggtcaggaaactactcagtaggtacccaggcttcttcagggatcacgtcctaggcagg
gacgtgtatttgacacttaggttgccgaatccctgggctgagaccgccgagaagaagcta
ttttcgcaagcccttgagttaatacccacggcctacgatgtggccagggagttctatggc
actgatgacattaatggggtattccaggtaatacttccattaacctcgagggccgaggaa
ctcgtatttacgtataggtattacgagagggtcgtcgccggtaaggcattcattgagtta
acccctggtgtcagggtcatggatgtcctgggcagtgttaggccgagcacaatagacgtg
atacccctcatagaggacctgggctcaatgcttaatgttggcaaaataatcattggttat
tggagggtggttaggccgagctaccttaggatattcatagccaggtcggacccagcaatg
aactacggcttaatacccgcagtcctcatggcgaaaatagccctcaataaggcgttgaac
ctgggcagggaacttgggcttgagatatacccaataattggcgttggcccaacaccattt
aggggcaacttaacgccacacaacgtggataacgtcgttagggagtacccatgcgtacac
accttcaccgttcagtcggcatttaggtacgactacccagagggtgaggtcattaacgcc
atttcgaagctgaacaataggaagccggacggtggctgtgatattcctaaccatggggtg
ctcattaacgtaattaataagtacgtggttaattaccaaagggagattgagggacttgcg
aacgttataaatagggtttcaaactacgtacctaggaggagagccaggaaattgcacata
ggcctattcggctacagcaggggctttaggggcgtggttcttcctagggctatcacgttc
gttgctgcgctatattcgttaggcataccgcctgaggtgttgggtgtttccacaattaat
gaattgagtgatagggagtattcagcgttgagtgaggcctatgtaaacctaaggcatgac
ctaagcatggcggctaggtacgtatgccacgagtgcctggacatgctcacgaaattaggt
aattcctttgggatcaccagggaggtcattgacatggttaagagagatattaagacgctt
gaggagatgggcattaaaacagggcccagcgactacgatagtagaaagcatgagttgttg
actcaattattcattaattcattggttgagggtaaggaggatgacgctgttaagtacatg
gttgagatggcgttgataaggcatgcaataggctaa

DBGET integrated database retrieval system