KEGG   Vibrio sp. EJY3: VEJY3_14160Help
Entry
VEJY3_14160       CDS       T01683                                 

Definition
(GenBank) protein translation elongation factor Tu (EF-TU)
  KO
K02358  
elongation factor Tu
Organism
vej  Vibrio sp. EJY3
Brite
Translation factors [BR:vej03012]
 Eukaryotic Type
  Elongation factors
   VEJY3_14160
 Prokaryotic Type
   VEJY3_14160
Mitochondrial biogenesis [BR:vej03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    VEJY3_14160
Exosome [BR:vej04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   VEJY3_14160
  Exosomal proteins of breast cancer cells
   VEJY3_14160
  Exosomal proteins of colorectal cancer cells
   VEJY3_14160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1:complement(3172025..3173209)
Genome map
AA seq 394 aa AA seqDB search
MSKAKFERVKPHVNVGTIGHVDHGKTTLTAAICTTLAKVYGGEAKDFASIDNAPEERERG
ITISTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGGILVVAATDGPMPQTREHI
LLGRQVGIPYIIVFMNKCDMVDDEELLELVEMEVRELLSEYDFPGDDLPVIQGSALGALN
GEEQWEAKIVELAEALDSYIPEPERAVDLPFLMPIEDVFSIQGRGTVVTGRIERGILNVG
DEVAIVGIKDTITTTCTGVEMFRKLLDEGRAGENVGALLRGTKRDEVERGQVLAKPGSIT
PHTKFESEVYVLSKDEGGRHTPFFKGYRPQFYFRTTDVTGDITLPEGVEMVMPGDNVQMT
VELIAPIAMDEGLRFAIREGGRTVGAGVVAKIFD
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
gtgtctaaagcaaaatttgaacgtgtaaaaccacacgtaaacgttggtactatcggccac
gttgaccacggtaaaacaactctaacagcagctatctgtactactcttgctaaagtgtac
ggcggtgaagcgaaagacttcgcatctatcgataacgctccagaagagcgtgagcgcggt
atcacaatctctacttctcacgtagagtacgacactccaactcgtcactacgcacacgta
gactgcccaggacacgctgactatgttaaaaacatgatcactggtgctgcgcaaatggac
ggtggtatcctagttgttgctgcaacagatggcccaatgcctcaaactcgtgagcacatc
ctactaggccgtcaggttggtatcccatacatcatcgtattcatgaacaaatgtgacatg
gttgacgatgaagagctactagaactagtagaaatggaagttcgtgagcttctatctgag
tacgatttcccaggtgatgacctaccagttatccaaggttctgcactaggcgcactaaac
ggcgaagagcagtgggaagcgaaaatcgttgaactagcagaagcgctagattcatacatc
ccagaaccagagcgtgcagtagacctaccgttcctaatgccaatcgaagacgtattctcg
atccaaggccgtggtactgtagtaactggtcgtatcgaacgtggtatcctaaacgtaggt
gacgaagttgctatcgttggtatcaaagacaccatcactactacatgtactggtgttgaa
atgttccgtaagcttctagacgaaggtcgtgcgggtgagaacgttggtgcacttctacgt
ggtactaagcgtgacgaagtagaacgtggtcaagtactagctaagccaggttcaatcact
ccacacactaaattcgaatcagaagtatacgtactgtctaaagatgaaggtggtcgtcac
actccattcttcaaaggctaccgtccacagttctacttccgtacaactgacgtaactggt
gacatcacgctaccagaaggcgtagaaatggtaatgccaggcgacaacgtacaaatgact
gtagagctaatcgcaccaatcgcaatggacgaaggtctacgtttcgcgatccgtgaaggt
ggccgtacagtaggtgctggtgttgttgctaagatcttcgactaa

DBGET integrated database retrieval system