KEGG   Vibrio sp. EJY3: VEJY3_22261Help
Entry
VEJY3_22261       CDS       T01683                                 

Definition
(GenBank) alpha-amylase
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
vej  Vibrio sp. EJY3
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vej00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    VEJY3_22261
Enzymes [BR:vej01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     VEJY3_22261
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2:complement(1455058..1456410)
Genome map
AA seq 450 aa AA seqDB search
MSGLQEIQSSGANVILHAFDWKYADIARRAKEIHELGYGSVLVSPPMKSANDERWWQRYQ
PQDYRVIDNALGNTQDFIHMVNELGRFGVLVYADVVFNHMANEAHMRPDLQYPSKEILQE
YQKNPEKYQALKLFGDLSEPLFTEEDFVTAFGIKNWKDKWQVQNGRITGGPADPGLPTLR
VCDHVVEQQRAYLKALKMIGVKGFRIDAAKHMTLEHLKLVWTDDITQDVHIFGEIITDGG
ATVEEYQLFLEPYLQETRLGAYDFPLFTTIFKAFSKNGSFKTLIDPYCFGEALSPGRAIT
FAVTHDIPNNDVFLDLVMDEEDEWLAYAYILGRDGGVPLVYTDLDTSGIKGKNGKPRWKD
AWSDPRMATMIKFHNAVHGQPMKVLEGNDDMLVLERGEQGIVVLNKSTRPQSLSLAIEGK
WLDMMTGNSVSSQDEIKVPAKSSMLLLAQL
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgagtggcttacaggaaatacaatcatctggtgcgaacgtgattctgcatgcttttgat
tggaagtatgctgacattgcccgacgtgcaaaagagatccatgagctaggctatggttct
gttctggtctctccaccaatgaaaagcgctaacgacgaacgctggtggcagcgctatcaa
cctcaagattatcgtgttatcgacaatgcccttggtaacactcaagattttatccatatg
gttaatgaactgggccgttttggtgtacttgtgtacgcagacgttgtgttcaaccatatg
gcgaatgaagcgcacatgcgcccagatctgcaatacccaagcaaagaaattttacaggaa
taccaaaagaatccagagaaataccaagcgctcaagctgtttggtgacctatctgagccg
ctattcactgaagaagattttgtgacagcgtttggtattaagaactggaaagacaaatgg
caagtacaaaatggccgtattactggaggaccagcggatcccggtttaccgactttgcgt
gtttgtgatcatgttgttgagcagcaacgagcctatttaaaagcactgaaaatgatcggg
gtgaaagggttccgtattgatgcggctaaacatatgacccttgagcatcttaagctagtc
tggaccgacgatattacccaagatgtgcacatttttggcgagatcattacagatggcggg
gcgaccgtcgaagagtatcagctgtttctagagccatatttacaagaaactcgcttaggt
gcctatgacttcccgctgtttaccaccatatttaaagcgttttctaaaaacggcagtttt
aagacgctaattgatccgtattgtttcggtgaggcactgtctccggggcgagccattact
tttgccgtgacgcatgacatcccgaataacgatgtgttcctcgacttagttatggatgaa
gaagacgaatggctggcgtatgcgtatatattgggtcgagatggcggtgttcctctggtt
tacaccgatttagacaccagtggcattaaaggtaaaaatggcaaaccaagatggaaagat
gcatggagtgatcctcggatggccaccatgattaagttccacaacgccgttcatggtcaa
cctatgaaggttctcgaaggtaacgacgacatgctggtgttagagcggggggagcaaggt
attgttgtcctcaacaaatcaactcgtccgcagtctttgtcgcttgcaatagaaggaaag
tggttagatatgatgactggaaactcagtttcgtcgcaagatgagatcaaggtaccggcc
aagtcgtcgatgctacttttggcccagttgtag

DBGET integrated database retrieval system