KEGG   Vitreoscilla filiformis: VITFI_CDS1043Help
Entry
VITFI_CDS1043     CDS       T04960                                 

Definition
(GenBank) Ribulose-bisphosphate carboxylase small chain
  KO
K01602  
ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
vff  Vitreoscilla filiformis
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:vff00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    VITFI_CDS1043
Enzymes [BR:vff01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     VITFI_CDS1043
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1113150..1113587
Genome map
AA seq 145 aa AA seqDB search
MMTNPTGRLTQGQFSFLPDLTDAEIAAQIQYGLNQGYAWSIETTDDPHPRNTYWDMFGMP
MFDLQDAAGVLLELNNCRAMFPNHYIRLMAFDSTRGVESITMSFIVNRPAKEMGFGLVRQ
EVQGRSLRYTVHSYATDRPETQRYC
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atgatgaccaacccgaccggccggctcacccaaggccagtttagcttcttgcccgacttg
acggacgcggaaattgccgcgcagattcagtacgggctgaaccagggttatgcctggagc
atcgagaccaccgacgatccgcacccgcgcaacacctactgggacatgttcggtatgccc
atgtttgacttgcaggacgcggctggcgtgctgctggagttgaacaactgccgggcgatg
ttcccgaaccactacatccgcctcatggcgtttgacagcacgcggggcgtggagtccatc
acgatgagtttcatcgtcaaccgtccggccaaggagatggggttcggtctggtgcgccag
gaggtgcaaggccgcagcttgcgctacaccgtccacagctatgccaccgaccgtccggag
acgcagcggtattgctga

DBGET integrated database retrieval system