KEGG   Aiivibrio fischeri MJ11: VFMJ11_0930Help
Entry
VFMJ11_0930       CDS       T00754                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
vfm  Aiivibrio fischeri MJ11
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Quorum sensing
Brite
KEGG Orthology (KO) [BR:vfm00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    VFMJ11_0930
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    VFMJ11_0930
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    VFMJ11_0930
   00430 Taurine and hypotaurine metabolism
    VFMJ11_0930
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    VFMJ11_0930
Enzymes [BR:vfm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     VFMJ11_0930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
I:complement(973320..974963)
Genome map
AA seq 547 aa AA seqDB search
MVTDNKTADASFESLLRIFTVPEAPDSTLGIIEKELSQNLNQFLREHIVAEEKPLTEIEK
DFTDSSMPESPTYVSEHTEHLLDTLVSQSVHTSAPSFIGHMTSALPYFLMPLSKIMIALN
QNLVKIETSKAFTPLERQVLGMLHRLIFGQKDSFYQHWMHSADHSLGAFCSGGTIANITA
LWVARNRLLKPEGDFEGIAKQGLFAALTHYKCNGLAIFVSERGHYSLKKAADVLGIGQDG
VIAVKTDNNNRVCLDDLELKITQAKAKNIKPLAIVGVAGTTETGSIDPLRELANVAQREG
CHFHVDAAWGGATLMSNTYRHLLDGIDLADSVTIDAHKQLYVPMGAGMVIFKDPELMSSI
QHHAEYILRKGSKDLGRHTLEGSRSGMAMLLYSCFNVISRPGYELLINQSIEKAHYFADL
IQQQDDFELITDPELCLLTYRYVPSNVKAALAIATDEQKLEIYEHLDNLTKYIQKTQRET
GKSFVSRTRLTPEAYQHQPTIVFRVVLANPLTTKEILQNVLIEQREIASSSEISLPLLNQ
IVDKILH
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atggtaacagacaacaaaacagcagatgcgagctttgaaagcctgctgcgaatttttact
gttccggaagctcccgattcgactcttggaataattgaaaaagaactttcacagaactta
aatcaatttttgagagagcatattgttgccgaagaaaagccattgacggaaatcgaaaaa
gattttaccgactcatcaatgcctgaatcgccaacctatgtatccgaacatactgagcac
ctgttagatacccttgtatctcaatccgttcatacctctgcaccaagctttattggccac
atgacatcggcattgccttactttttaatgccactttcaaaaatcatgattgccctaaac
caaaacttggtaaaaattgaaacatcaaaagcatttaccccgttagagcgtcaagtgctt
ggtatgctacaccgtctaattttcggtcaaaaagacagtttctatcaacactggatgcac
agcgctgatcattctctgggtgctttttgctcaggtggcaccattgctaatattacagcg
ttatgggttgcaagaaatcgcctattaaaaccagaaggtgattttgaaggcattgccaaa
caaggactttttgcagctcttacgcattataagtgcaatgggttagctattttcgtttca
gaacgtggtcactactcactcaaaaaagcagccgatgtattagggattggtcaagatggt
gttattgccgttaaaactgacaacaacaatcgtgtttgccttgatgatttagagcttaaa
attacccaagcaaaagcgaaaaacattaagccattggctattgttggggttgcaggaacc
acagaaacaggttcaattgacccactgcgtgagttagcaaatgttgctcaacgtgaagga
tgtcatttccatgtggatgccgcttggggcggtgcaacattaatgtcgaatacgtaccga
caccttttggatggtattgatttagccgattccgtaacgattgatgcacataaacaacta
tacgtaccaatgggtgcaggtatggttatctttaaagatcctgaattaatgtcttctatc
cagcatcatgctgagtacattcttcgtaaagggtctaaagatttaggtcgtcacacactt
gaaggttctcgaagtggtatggcgatgttgctttattcttgtttcaacgtgatcagtcgc
cctggttatgaattattaatcaaccaaagtattgaaaaagcacactactttgctgactta
attcaacagcaagatgattttgaactgataacagatcctgagctgtgtttgctgacttat
cgctatgttccaagtaatgtaaaagcggcactggccattgcaactgacgagcaaaagctt
gagatttatgaacacttggataatctcaccaagtacattcaaaaaacgcaacgtgaaact
gggaagtcttttgtttctcgaactcgattaacacctgaagcttatcagcatcaaccaacc
atcgttttcagagtcgtattagcaaatccattaacaacaaaagaaatactgcaaaatgtc
ttaattgagcaaagagaaattgcgagcagcagtgaaatatctttacctcttttaaaccaa
attgtagacaaaattcttcactaa

DBGET integrated database retrieval system