KEGG   Vibrio furnissii: vfu_A01638Help
Entry
vfu_A01638        CDS       T01680                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
vfu  Vibrio furnissii
Pathway
vfu00240  Pyrimidine metabolism
vfu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vfu00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    vfu_A01638
Enzymes [BR:vfu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     vfu_A01638
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22 AAA_30 SNF2_N
Motif
Other DBs
NCBI-ProteinID: ADT86806
UniProt: F0LSI7
LinkDB All DBs
Position
1:1705180..1705758
Genome map
AA seq 192 aa AA seqDB search
MAQMYFYYSAMNAGKSTTLLQSSFNYQERGMTPVIFTAAIDDRFGVGKVSSRIGLEADAH
LFTSDTNLFDAIKQLHQNEKRHCVLVDECQFLTKEQVYQLTEVVDKLDIPVLCYGLRTDF
LGELFEGSKYLLSWADKLIELKTICHCGRKANMVIRTDEHGNAISEGDQVAIGGNDKYVS
VCRQHYKEALGR
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
ttggctcagatgtatttttattactcggcaatgaacgcgggtaagtcgaccacactgctt
caatcatcgtttaactatcaagaacgcggcatgacgcccgtgatcttcaccgcggcgatc
gatgatcgttttggcgtgggtaaagtgagttctcgaatcggcttagaagcggatgcacat
ctctttacctcggacaccaatctgtttgatgccatcaagcaactgcatcaaaacgaaaaa
cgtcattgtgtgttggtggatgagtgtcagtttctgaccaaagagcaagtttatcaactg
accgaagtggtggataaactggatattcccgtactctgctacggtttacgcactgacttt
ttgggggagctgtttgaaggcagtaaatacctgttgtcgtgggcagataagctgattgag
ctgaaaaccatttgtcattgtgggcgcaaagccaacatggtgatccgcacggatgagcat
ggcaatgcgatttccgaaggtgaccaagtggcgattggtggcaacgacaaatacgtgtcg
gtgtgtcgtcagcattataaagaagcgttggggcgctaa

DBGET integrated database retrieval system