KEGG   Vibrio gazogenes: BSQ33_03400Help
Entry
BSQ33_03400       CDS       T04933                                 

Definition
(GenBank) aminotransferase
  KO
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
vga  Vibrio gazogenes
Pathway
Arginine biosynthesis
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:vga00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BSQ33_03400
   00290 Valine, leucine and isoleucine biosynthesis
    BSQ33_03400
   00220 Arginine biosynthesis
    BSQ33_03400
Enzymes [BR:vga01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     BSQ33_03400
    2.6.1.66  valine---pyruvate transaminase
     BSQ33_03400
Amino acid related enzymes [BR:vga01007]
 Aminotransferase (transaminase)
  Class I
   BSQ33_03400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1:754786..756000
Genome map
AA seq 404 aa AA seqDB search
MQNIGMSLKLDNVCYDIRGPVLKHAKRMEEEGHKILKLNIGNPAPFGFDAPDEILVDVIR
NLPTSQGYCDSKGIYSARKAVVQHYQKKGLRALDVEDVYIGNGASELIVMSMQALLNNGD
EMLVPAPDYPLWTASVSLSGGNAVHYLCDEESDWYPDLEDIKKKITPNTRGIVLINPNNP
TGAVYSRDFLLEFIEIARQHNLIIFADEIYDKILYDGATHTPISTLADDVLMVTFNGLSK
AYRVCGFRGGWMFLTGPKHLAAGYVSGLDILASMRLCANVPMQHAIQTALGGYQSINELI
LPGGRLLEQRDRAWEMINQIPGVSCVKPKGAMYLFPKIDTKMYNIHDDQKMVLDFLIQEK
VLLVQGSGFNWPKPDHFRIVTLPHVEDLEIAISRFEQFLSTYRQ
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaatattgggatgtcattaaaacttgataatgtctgctacgacattcggggtcct
gtactcaaacatgctaaacgaatggaggaagagggacataaaatcctaaagctcaatatc
ggcaatccggcaccttttggctttgatgcccctgatgaaatcctcgtcgatgtcattcgt
aatctgccaacatcgcaaggttattgcgactccaaagggatctattctgcccgtaaagcc
gtggtgcagcactatcagaaaaaaggattacgcgccctcgatgtcgaagacgtgtatatc
ggtaacggtgcttctgagctgatcgtcatgtcaatgcaagcgctgttgaataatggcgat
gaaatgttagtaccggcaccggattacccactgtggacggcctcggtctcgctctccggc
gggaatgcggtgcactatctgtgtgatgaagagtcagactggtatcccgatctggaagac
attaaaaagaaaatcaccccgaacacccgcggtattgtactcatcaacccgaataatccg
acaggcgcggtttacagccgtgattttctgttggaatttatcgaaattgcccggcagcat
aatctgattatctttgccgatgagatctacgacaagattttatacgacggcgcaacccat
acaccgatctcaacgctcgctgatgatgtcctcatggtgacattcaacgggctgtcaaaa
gcttatcgtgtttgtggattcagagggggctggatgttcctcacgggtccgaaacatctt
gctgcgggttatgtctccgggctggatatactggcgtcgatgcgcttgtgtgccaatgtg
ccgatgcaacatgcgattcaaaccgcgctgggcggctatcagagtatcaatgaactgatt
ctgcccggtggcagattattagaacagcgcgatcgcgcatgggaaatgatcaatcagatt
ccgggcgtgtcctgcgtcaaacccaaaggggcgatgtatttattcccgaaaattgatacc
aagatgtataacatccacgacgaccagaaaatggtgctcgattttctgattcaggaaaaa
gttttactggttcagggcagcggcttcaactggccgaaacccgaccatttccgtatcgtc
acactgccgcacgttgaagatctggaaattgccatcagtcgtttcgagcagttcctctcg
acttaccgacagtaa

DBGET integrated database retrieval system