KEGG   Vibrio campbellii: VIBHAR_06578Help
Entry
VIBHAR_06578      CDS       T00589                                 

Definition
(GenBank) hypothetical protein
  KO
K04565  
superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
vha  Vibrio campbellii
Brite
Enzymes [BR:vha01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     VIBHAR_06578
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
II:complement(1725906..1726418)
Genome map
AA seq 170 aa AA seqDB search
MKLSALMAACVLLSGSALADELTVEMTDLATGKSVGEVAITTSDYGTVFTPNLSGLPSGA
HGFHIHANGSCDSRIKDGKTVLGGAAGGHYDPKGTGQHGFPWTDGNHLGDLPAMYVDANG
MANQPVLAPRVKLADVKGRALMVHFGGDNHSDHPAKLGGGGARMVCGVIK
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgaaactaagtgctttaatggcggcttgcgttttgctatcaggttcggctcttgccgat
gagttaacggtggaaatgaccgatcttgcaacaggtaagtctgttggcgaagttgcgatt
acaactagcgattatggtacggttttcactccaaacttaagcggtcttccatctggtgct
catggtttccatatccacgctaatggctcttgtgatagcagaattaaagatggaaaaaca
gtgttaggtggtgctgctggtggtcactatgaccctaaaggtactggtcagcatggattt
ccttggactgatggcaaccacttaggtgatctacctgcaatgtacgtagatgcaaacggc
atggcgaatcaacctgtgcttgcaccacgagttaagctagcggatgtaaaaggtcgagcg
cttatggttcactttggcggtgacaaccactcagatcatccagcgaaacttggcggtggt
ggtgcgcgcatggtttgtggcgtaattaagtaa

DBGET integrated database retrieval system