KEGG   Virgibacillus halodenitrificans: BME96_15045Help
Entry
BME96_15045       CDS       T04548                                 

Definition
(GenBank) hypothetical protein
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
vhl  Virgibacillus halodenitrificans
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:vhl00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    BME96_15045
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    BME96_15045
Enzymes [BR:vhl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     BME96_15045
Bacterial toxins [BR:vhl02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   BME96_15045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(2985867..2988284)
Genome map
AA seq 805 aa AA seqDB search
MKNVYAIIISVVFFIFIGADQKLVEASTSKTEPIVSVENEQIENGYFTNLNSEIDKLKGL
EEGTIVVRFRYTGSSIMSLFSLSNSNLANGHFHLYISPSSIGSENRFQKPGEPQENVHTS
VAANLKEGHVYTLAMVVDKEAGYKYFLDGELIKKDTTTPKKFLNNIYKPNSAQLGRTERA
AGGNNYPFEGDIDFAKIYNKPLSDEVLTAVTGVTAAAPLVNPMPDEAYVTDPESIFYPGF
MDSNNYRIPALFYTEKGTLIAGIDRRVENGADSPNNIDAVIRRSFDDGDTWEENGVMVND
YPDQASNIDLAFLQDKSNERIFALVDGFPHGAGLMGGFGVNSYKGTGFKTIDGKKYMFLT
DESGKEYTVRDGGQVYDNEGNQTEYKVDDRRNLYLNGEKIDNIFSKTTPLKPYKTSYLEL
YYSDDEGETWEGTIDLNDEVKEEWMAFLGTGPGNGIQLTEGEHKGRLVFPVYFLNDNFKQ
ASAVVYSDDNGKTWHRGESPNEGRVVGNGEVIHEKTFNNSAYEVTESQVVEMPDGQLKLF
MRNHSGYAQIATSFDGGETWEEEVVTEKDLVAPYSQMSVIRYDGKVDDKEALIFSSANNS
ASRVDGTVRIGLIEESGTYGNGHTKYSIDWKYDQLVKEGHYGYSSLTNLSDGNIGLFYEG
TPNTVMDFRKFNTDFVKWEKEKEAPAPTVNSFSTIEKTPNVYRPGETIQVEMTFDSYVML
MGGRSLTGTLDGTEIEFKFADQVSANTILFEGTIPDIHPRKRELDLSFSNNLDVYNVYGK
TLDKQEANSKLIDEVRIRANGKGRK
NT seq 2418 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatgtatacgctatcattatctctgtagtattttttattttcataggagcagat
cagaaactggtagaagcctctacatcaaagactgaaccaattgtaagtgtagagaatgaa
caaatagaaaatggttatttcacaaatcttaatagtgaaatcgataagctaaaagggtta
gaagaaggtacgattgttgttcgctttcgttatacgggctcttctattatgtcattattt
tcattaagtaatagtaatctagctaatgggcatttccatttatatatctccccgtcctcc
attggcagtgaaaatcgatttcaaaagccaggggaaccccaagaaaacgttcatacatct
gttgcagcaaatctaaaagaaggacatgtctatacactggcaatggtggtagataaggaa
gcaggctataaatacttcctggatggagaattaattaaaaaagacactacgactccaaag
aaatttttaaacaatatctacaaaccgaacagtgcccaacttggcaggacagagagagca
gctggtggaaacaattatccttttgagggggatatcgattttgcgaagatatacaataag
ccactctctgatgaagttttaactgcagttacaggtgtgacagctgctgcaccgcttgtg
aatccaatgccagacgaagcttatgtaacggaccctgaaagtatcttttacccaggcttc
atggattcgaataattatcgaattccagcactattttacacagaaaagggtacattgatt
gctgggatcgaccgccgtgtagaaaatggtgctgattctcccaataatattgatgctgtt
attcgaagaagctttgatgatggagatacatgggaagagaatggtgtgatggtcaacgac
tatccagatcaggcttccaatatcgatttagctttcctgcaggataagtcaaacgagcgg
atttttgccttggttgatggctttccacatggtgcaggacttatgggtggttttggagtc
aactcctataaaggaactgggttcaaaacaatcgatgggaaaaagtatatgttcctcaca
gatgaatctggaaaggaatatactgttcgtgatggtggacaagtgtatgataatgaaggg
aaccaaacggaatataaagtagatgatagaagaaacttatacttgaatggtgaaaaaata
gacaatatatttagtaagacaacacctctaaaaccatataaaacttcctatctcgaactc
tattatagtgatgatgaaggggaaacatgggaagggaccattgacttaaatgatgaggtg
aaagaagaatggatggcattcctaggtactggcccaggtaacggtattcaattaacagaa
ggtgaacataaaggaagacttgttttcccggtgtactttctaaatgataactttaaacaa
gctagtgccgttgtttatagtgatgataatgggaagacatggcaccgtggtgaatcacct
aatgaaggaagagttgtgggtaacggagaggtcattcatgagaaaacctttaacaatagt
gcatatgaggttactgaatcacaggttgttgaaatgcctgatggtcagctgaaattgttt
atgagaaaccattctggctacgcacaaattgctacaagctttgatggtggagaaacatgg
gaagaagaagttgtaacggaaaaggatttggttgcaccgtatagccaaatgtctgttata
cgttacgatgggaaggtcgatgacaaagaagcacttatcttctcaagtgcaaacaactct
gccagcagagtggatggaacagtaagaatagggctaatagaagaatcaggaacttatgga
aatgggcatacaaaatattcaattgattggaaatatgatcagcttgtcaaagaagggcat
tatggctattccagtcttactaatttatcagatggaaatattggtcttttttatgaaggt
accccaaatactgtcatggattttaggaagtttaatactgactttgtgaagtgggagaag
gaaaaagaggctcccgcaccaactgttaattctttcagcacaatagagaaaaccccaaat
gtttatcgacctggtgaaactattcaggtagagatgacttttgatagctatgtcatgttg
atgggtggccggagccttactggaacgctcgatggcacggaaattgaatttaagtttgcg
gaccaagtatctgccaatacaattttatttgaagggaccatccctgatattcatcctaga
aaacgtgagttagacctttcgtttagtaataacctagatgtatataatgtttatggaaag
actctagataaacaggaagcaaattcaaaactaattgatgaagtacggattcgagctaac
gggaaagggagaaaatag

DBGET integrated database retrieval system