KEGG   Vulgatibacter incomptus: AKJ08_2640Help
Entry
AKJ08_2640        CDS       T04035                                 

Definition
(GenBank) Peptidyl-dipeptidase A precursor
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
vin  Vulgatibacter incomptus
Brite
Enzymes [BR:vin01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     AKJ08_2640
Peptidases [BR:vin01002]
 Metallo Peptidases
  Family M2
   AKJ08_2640
Exosome [BR:vin04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AKJ08_2640
CD molecules [BR:vin04090]
 Proteins
  AKJ08_2640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(3114542..3116383)
Genome map
AA seq 613 aa AA seqDB search
MNISKLISGIVLAASMASCATTGGPSLEPVEVAFAAPTAAEAKEFATRVDAELKAILTRV
STAEWVKSTYITDDTEQLSAWANEEMMAFLSKAVADSKRFDGVEVDEATGRMLHLLRLTS
ALPAPSEAAERAELASLAAKLEGMYGKGKWCGADGKAKCRDLGDLSETLAQSRKYEELLD
AWMGWHTISREMRPLYEQEVRLANQGAREIGFADLGELWKSGYDMSPADFEAETDRLWQQ
VKPLYDELHCYVRSQLVKKYGKDRVPARGPIPAHLLGNMWSQDWSNIYPLVEPYKGAASL
DVDASLKKQKYDAIRMAKLGESFFTSLGLKPLPETFWQRSMLVQPRDRDVVCHASAWDVT
SAGDVRIKMCIRPTEEDLITIHHELGHNYYYQQYDKLPVLFQSGANDGFHEAIGDAIALS
ITPGYLKQIGLISKVPSDDKGVVNVQMKMALQKIAFLPFGKMIDQWRWDVFSGKTASANY
NQAWWELKERYQGVAAPVARSEADFDPGAKYHIPANVPYTRYFLAHILQFQFHKALCDAA
GFQGPLHACSVYGSADAGEKLRAMLALGASKPWPDALEAMTGHREMDATPILEYFQPLRT
WLAEQNRGQQCGW
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atgaacatctccaagctgatctcaggaatcgtcctcgcggcctcgatggcctcgtgcgcc
accaccggcggaccctccctcgagccggtagaggtcgcattcgccgctcccaccgccgcc
gaggccaaggagttcgccacccgcgtcgacgccgagctgaaggcgatcctcacgcgagtc
tccaccgccgagtgggtgaagagcacctacatcacggacgacaccgagcagctctcggcg
tgggcgaacgaggagatgatggccttcctctcgaaggccgtcgccgactccaagaggttc
gacggcgtggaggtcgacgaggccaccggccggatgctgcacctcctgcgtctcacctcc
gcactcccggccccctccgaggccgccgagcgcgccgagctcgccagcctcgcggcgaag
ctcgaggggatgtacggcaagggcaagtggtgcggcgccgacggcaaggcgaagtgccgc
gacctcggcgacctctccgagaccctcgcgcagagccgcaagtacgaggagctcctcgac
gcctggatgggctggcacacgatctcccgcgagatgcggcccctctacgagcaggaggtc
cggctcgccaaccagggcgcccgcgagatcggcttcgccgacctgggcgagctctggaag
tccggctacgacatgagccccgccgacttcgaggcggagaccgaccggctctggcagcag
gtgaagccgctctacgacgagctccactgctacgtgcgcagccagctcgtgaagaagtac
ggcaaggatcgggtgcccgcccgcggccccatccccgcgcacctgctgggcaacatgtgg
tcgcaggactggtcgaacatctacccgctggtggagccgtacaagggcgcggccagcctc
gacgtcgacgcctcgctgaagaagcagaagtacgacgccatccggatggcgaagctcggc
gagtccttcttcacctcgctgggcctgaagcccctgcccgagaccttctggcagcggtcg
atgctggtgcagccccgcgaccgtgacgtggtctgccacgccagcgcgtgggacgtgacc
tccgccggcgacgtgcgcatcaagatgtgcatccggcccaccgaggaggatctgatcacg
atccaccacgagctcggtcacaactactactaccagcagtacgacaagctcccggtgctc
ttccagtccggcgccaacgacggcttccacgaggcgatcggcgacgcgatcgcgctctcg
atcacgccgggctacctcaagcagatcgggctgatctcgaaggtcccgtcggacgacaag
ggcgtggtcaacgtccagatgaagatggcgctccagaagatcgccttcctgccctttggc
aagatgatcgatcagtggcgctgggacgtgttctcgggcaagaccgcgtcggcgaactac
aaccaggcgtggtgggagctgaaggagcgctaccagggcgtggcggctccggtggcccgc
tccgaggccgacttcgatccgggcgccaagtaccacatcccggcgaacgtgccgtacacg
cgctacttcctggcgcacatcctccagttccagttccacaaggcgctctgcgacgcggcg
ggcttccaggggccgctccacgcctgctccgtctacggcagcgcggacgcgggcgagaag
ctccgcgcgatgctggcgctgggcgcgagcaagccctggcccgacgccctcgaggcgatg
accggccaccgcgagatggatgcgacgccgatcctcgagtacttccagccgcttcggacg
tggctcgcggagcagaaccgcggccagcagtgcggctggtag

DBGET integrated database retrieval system