Vulpes lagopus (Arctic fox): 121500740 Help Entry 121500740         CDS       T07435                                  Symbol PFN1 Name (RefSeq) profilin-1   KO K05759   profilin Organism vlg  Vulpes lagopus (Arctic fox) Pathway vlg04015   Rap1 signaling pathway vlg04810   Regulation of actin cytoskeleton vlg05014   Amyotrophic lateral sclerosis vlg05132   Salmonella infection Brite KEGG Orthology (KO) [BR:vlg00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     121500740 (PFN1)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     121500740 (PFN1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     121500740 (PFN1)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     121500740 (PFN1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:vlg04131]     121500740 (PFN1)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:vlg04812]     121500740 (PFN1)    04147 Exosome [BR:vlg04147]     121500740 (PFN1) Membrane trafficking [BR:vlg04131]  Others   Actin-binding proteins    Others     121500740 (PFN1) Cytoskeleton proteins [BR:vlg04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      121500740 (PFN1) Exosome [BR:vlg04147]  Exosomal proteins   Proteins found in most exosomes    121500740 (PFN1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  121500740 NCBI-ProteinID:  XP_041628707 LinkDB All DBs Position 10:58054761..58057453 Genome browser AA seq 140 aa AA seqDB search MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFF VNGLTLGGQKCSVIRDSLLQDGEFTMDLRTKSSGGAPTFNITVTMTAKTLVLLMGKEGVH GGMINKKCYEMASHLRRSQY NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggccggctggaacgcctacatcgacaacctcatggcggacgggacctgtcaggacgcg gccatcgtgggctataaggactcgccctccgtgtgggccgccgtccccgggaagaccttc gtcaacatcacgccagctgaggtcggtgtcctggttggcaaagaccggtcgagttttttc gtgaacgggctgacactgggaggccagaagtgttctgtgatccgggactcgctgctgcag gatggggagtttactatggaccttcgtaccaagagcagcggtggagcgcccactttcaac atcactgtcaccatgactgccaagacgctagtcctgctgatgggcaaagaaggtgtccac ggtggtatgatcaacaagaaatgttatgaaatggcttcccacctgcggcgttcccagtac tga

DBGET integrated database retrieval system