KEGG   Vibrio parahaemolyticus RIMD 2210633: VP1151Help
Entry
VP1151            CDS       T00120                                 

Definition
(RefSeq) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
vpa  Vibrio parahaemolyticus RIMD 2210633
Pathway
vpa00240  Pyrimidine metabolism
vpa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vpa00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    VP1151
Enzymes [BR:vpa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     VP1151
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22 AAA_30 AAA_14
Motif
Other DBs
NCBI-GeneID: 1188656
NCBI-ProteinID: NP_797530
UniProt: Q87QJ8
LinkDB All DBs
Position
I:1208873..1209451
Genome map
AA seq 192 aa AA seqDB search
MAQMYFYYSAMNAGKSTTLLQSSFNYQERGMTPVIFTAALDDRYGVGKVSSRIGLQSDAH
LFRPDTNLYQEIAALHEVEKRHCILIDECQFLSKEQVYQLTEVVDKLHIPVLCYGLRTDF
LGELFEGSKYLLSWADKLVELKTICHCGRKANMVIRTDEHGVAIKEGDQVAIGGNDRYVS
VCRQHYKEALGK
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
gtggctcagatgtatttctattactcagcaatgaatgcgggtaaatcgacaactcttctt
caatcttcatttaactaccaagaacgcggtatgacgccagtgattttcactgcggcgttg
gacgaccgctatggtgtaggcaaagtaagttctcgtattggtttacaatcggacgcgcat
ttgttccgtccagatacgaacctatatcaagagattgcagccctgcatgaagtcgaaaaa
cgtcactgtattcttattgacgagtgtcagttcctatcgaaagagcaggtttaccaactt
acagaggtagtggataagctgcatattccagtactttgctatggtcttcgtaccgatttt
cttggcgaactttttgaaggcagtaagtacctactctcttgggctgataagctggttgag
ttgaagacgatttgccactgtggccgaaaagcaaacatggttatccgcaccgacgaacac
ggagtcgcaatcaaagaaggtgaccaagtggcaattggtggcaacgaccgttatgtctcg
gtttgccgtcagcactacaaagaagccctaggtaaataa

DBGET integrated database retrieval system